Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 5734872..5735391 | Replicon | chromosome |
Accession | NZ_CP102780 | ||
Organism | Pandoraea commovens strain LB-19-202-79 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | NTU39_RS25830 | Protein ID | WP_257958858.1 |
Coordinates | 5735101..5735391 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NTU39_RS25825 | Protein ID | WP_150663612.1 |
Coordinates | 5734872..5735114 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTU39_RS25795 (NTU39_25795) | 5729874..5731187 | - | 1314 | WP_257958857.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NTU39_RS25800 (NTU39_25800) | 5731199..5731684 | - | 486 | WP_150663609.1 | hypothetical protein | - |
NTU39_RS25805 (NTU39_25805) | 5731711..5732508 | - | 798 | WP_150663610.1 | BON domain-containing protein | - |
NTU39_RS25810 (NTU39_25810) | 5732629..5733216 | - | 588 | WP_039393910.1 | phosphoheptose isomerase | - |
NTU39_RS25815 (NTU39_25815) | 5733348..5733701 | - | 354 | WP_150664165.1 | YraN family protein | - |
NTU39_RS25820 (NTU39_25820) | 5733806..5734690 | + | 885 | WP_150663611.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NTU39_RS25825 (NTU39_25825) | 5734872..5735114 | + | 243 | WP_150663612.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NTU39_RS25830 (NTU39_25830) | 5735101..5735391 | + | 291 | WP_257958858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11100.01 Da Isoelectric Point: 10.8976
>T254189 WP_257958858.1 NZ_CP102780:5735101-5735391 [Pandoraea commovens]
MTTYDLQFLPSALKEWQALDASIQRQFKTKLRRRLQQPQVPGSRLKAMPDCYKIKLASAGYRLIYRVNESAITVLVVAVG
KRENLKVYRNASERLT
MTTYDLQFLPSALKEWQALDASIQRQFKTKLRRRLQQPQVPGSRLKAMPDCYKIKLASAGYRLIYRVNESAITVLVVAVG
KRENLKVYRNASERLT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|