Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbE-relB/ParE-YafN
Location 1901014..1901530 Replicon chromosome
Accession NZ_CP102772
Organism Bosea sp. NBC_00550

Toxin (Protein)


Gene name stbE Uniprot ID -
Locus tag NWE53_RS09080 Protein ID WP_265053997.1
Coordinates 1901246..1901530 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NWE53_RS09075 Protein ID WP_265053996.1
Coordinates 1901014..1901259 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE53_RS09050 (NWE53_09060) 1896172..1897053 - 882 WP_265053991.1 glycosyltransferase family 2 protein -
NWE53_RS09055 (NWE53_09065) 1897167..1897469 - 303 WP_265053992.1 hypothetical protein -
NWE53_RS09060 (NWE53_09070) 1897486..1897857 - 372 WP_265053993.1 hypothetical protein -
NWE53_RS09065 (NWE53_09075) 1897863..1899647 - 1785 WP_265053994.1 aspartate--tRNA ligase -
NWE53_RS09070 (NWE53_09080) 1899784..1900923 + 1140 WP_265053995.1 ribonuclease D -
NWE53_RS09075 (NWE53_09085) 1901014..1901259 + 246 WP_265053996.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NWE53_RS09080 (NWE53_09090) 1901246..1901530 + 285 WP_265053997.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE53_RS09085 (NWE53_09095) 1901543..1902253 - 711 WP_265054855.1 flagellar type III secretion system pore protein FliP -
NWE53_RS09090 (NWE53_09100) 1902476..1903924 - 1449 WP_265053998.1 flagellar biosynthetic protein FliO -
NWE53_RS09095 (NWE53_09105) 1904135..1904536 + 402 WP_265053999.1 flagellar basal body rod protein FlgB -
NWE53_RS09100 (NWE53_09110) 1904540..1904950 + 411 WP_265054000.1 flagellar basal body rod protein FlgC -
NWE53_RS09105 (NWE53_09115) 1904965..1905288 + 324 WP_265054001.1 flagellar hook-basal body complex protein FliE -
NWE53_RS09110 (NWE53_09120) 1905338..1905604 + 267 WP_265054002.1 flagellar biosynthesis protein FliQ -
NWE53_RS09115 (NWE53_09125) 1905682..1906440 + 759 WP_265054856.1 flagellar biosynthetic protein FliR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(8-75)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11137.07 Da        Isoelectric Point: 10.8825

>T254185 WP_265053997.1 NZ_CP102772:1901246-1901530 [Bosea sp. NBC_00550]
MTTYRLAFLPSARKEWDKLGATLREQFKRKLAERLMNPRVQADALHGLPDHYKIKLRAAGYRLVYRVEDEEVPIVVVVIG
KRERSRVYEIARKR

Download         Length: 285 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8768.02 Da        Isoelectric Point: 4.3855

>AT254185 WP_265053996.1 NZ_CP102772:1901014-1901259 [Bosea sp. NBC_00550]
MQRVEAEIAVSVSDLKKNPTAVVAGARGNPIAILNHNRVMAYMVPAETYEAMMDALDDQALIEVAKARANEKSEPVSLDD
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References