Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 1901014..1901530 | Replicon | chromosome |
| Accession | NZ_CP102772 | ||
| Organism | Bosea sp. NBC_00550 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | - |
| Locus tag | NWE53_RS09080 | Protein ID | WP_265053997.1 |
| Coordinates | 1901246..1901530 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NWE53_RS09075 | Protein ID | WP_265053996.1 |
| Coordinates | 1901014..1901259 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWE53_RS09050 (NWE53_09060) | 1896172..1897053 | - | 882 | WP_265053991.1 | glycosyltransferase family 2 protein | - |
| NWE53_RS09055 (NWE53_09065) | 1897167..1897469 | - | 303 | WP_265053992.1 | hypothetical protein | - |
| NWE53_RS09060 (NWE53_09070) | 1897486..1897857 | - | 372 | WP_265053993.1 | hypothetical protein | - |
| NWE53_RS09065 (NWE53_09075) | 1897863..1899647 | - | 1785 | WP_265053994.1 | aspartate--tRNA ligase | - |
| NWE53_RS09070 (NWE53_09080) | 1899784..1900923 | + | 1140 | WP_265053995.1 | ribonuclease D | - |
| NWE53_RS09075 (NWE53_09085) | 1901014..1901259 | + | 246 | WP_265053996.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NWE53_RS09080 (NWE53_09090) | 1901246..1901530 | + | 285 | WP_265053997.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NWE53_RS09085 (NWE53_09095) | 1901543..1902253 | - | 711 | WP_265054855.1 | flagellar type III secretion system pore protein FliP | - |
| NWE53_RS09090 (NWE53_09100) | 1902476..1903924 | - | 1449 | WP_265053998.1 | flagellar biosynthetic protein FliO | - |
| NWE53_RS09095 (NWE53_09105) | 1904135..1904536 | + | 402 | WP_265053999.1 | flagellar basal body rod protein FlgB | - |
| NWE53_RS09100 (NWE53_09110) | 1904540..1904950 | + | 411 | WP_265054000.1 | flagellar basal body rod protein FlgC | - |
| NWE53_RS09105 (NWE53_09115) | 1904965..1905288 | + | 324 | WP_265054001.1 | flagellar hook-basal body complex protein FliE | - |
| NWE53_RS09110 (NWE53_09120) | 1905338..1905604 | + | 267 | WP_265054002.1 | flagellar biosynthesis protein FliQ | - |
| NWE53_RS09115 (NWE53_09125) | 1905682..1906440 | + | 759 | WP_265054856.1 | flagellar biosynthetic protein FliR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11137.07 Da Isoelectric Point: 10.8825
>T254185 WP_265053997.1 NZ_CP102772:1901246-1901530 [Bosea sp. NBC_00550]
MTTYRLAFLPSARKEWDKLGATLREQFKRKLAERLMNPRVQADALHGLPDHYKIKLRAAGYRLVYRVEDEEVPIVVVVIG
KRERSRVYEIARKR
MTTYRLAFLPSARKEWDKLGATLREQFKRKLAERLMNPRVQADALHGLPDHYKIKLRAAGYRLVYRVEDEEVPIVVVVIG
KRERSRVYEIARKR
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|