Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 127299..127840 | Replicon | chromosome |
Accession | NZ_CP102772 | ||
Organism | Bosea sp. NBC_00550 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NWE53_RS00600 | Protein ID | WP_265052471.1 |
Coordinates | 127299..127622 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NWE53_RS00605 | Protein ID | WP_265052472.1 |
Coordinates | 127619..127840 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWE53_RS00580 (NWE53_00580) | 123104..124252 | + | 1149 | WP_265052467.1 | alpha/beta hydrolase | - |
NWE53_RS00585 (NWE53_00585) | 124385..125389 | + | 1005 | WP_265052468.1 | alpha/beta fold hydrolase | - |
NWE53_RS00590 (NWE53_00590) | 125390..125848 | - | 459 | WP_265052469.1 | Lrp/AsnC family transcriptional regulator | - |
NWE53_RS00595 (NWE53_00595) | 125991..127274 | + | 1284 | WP_265052470.1 | cystathionine gamma-synthase family protein | - |
NWE53_RS00600 (NWE53_00600) | 127299..127622 | - | 324 | WP_265052471.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NWE53_RS00605 (NWE53_00605) | 127619..127840 | - | 222 | WP_265052472.1 | antitoxin MazE family protein | Antitoxin |
NWE53_RS00610 (NWE53_00610) | 127913..128650 | - | 738 | WP_265055043.1 | DUF3750 domain-containing protein | - |
NWE53_RS00615 (NWE53_00615) | 128936..130000 | + | 1065 | WP_265055044.1 | polyamine ABC transporter substrate-binding protein | - |
NWE53_RS00620 (NWE53_00620) | 130026..131180 | + | 1155 | WP_265052473.1 | ABC transporter ATP-binding protein | - |
NWE53_RS00625 (NWE53_00625) | 131362..132255 | + | 894 | WP_265052474.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11499.61 Da Isoelectric Point: 10.4471
>T254184 WP_265052471.1 NZ_CP102772:c127622-127299 [Bosea sp. NBC_00550]
MKRGDLVTVALAGDFGKPRPALIVQADPFDLTATVTVLLLSSDLVDAPLIRLTIQPNAANGLRLASQIMVDKAMTVRRDR
IGQIFGRVDPDMMIAVNRSLALFLGLG
MKRGDLVTVALAGDFGKPRPALIVQADPFDLTATVTVLLLSSDLVDAPLIRLTIQPNAANGLRLASQIMVDKAMTVRRDR
IGQIFGRVDPDMMIAVNRSLALFLGLG
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|