Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1348039..1348955 | Replicon | chromosome |
| Accession | NZ_CP102769 | ||
| Organism | Bacillus subtilis strain YZSR384 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | NVS73_RS07095 | Protein ID | WP_003244695.1 |
| Coordinates | 1348209..1348955 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | NVS73_RS07090 | Protein ID | WP_003232646.1 |
| Coordinates | 1348039..1348209 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NVS73_RS07055 (1344902) | 1344902..1345231 | + | 330 | WP_003232660.1 | XkdW family protein | - |
| NVS73_RS07060 (1345228) | 1345228..1345392 | + | 165 | WP_003232658.1 | XkdX family protein | - |
| NVS73_RS07065 (1345436) | 1345436..1346275 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
| NVS73_RS07070 (1346328) | 1346328..1346597 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| NVS73_RS07075 (1346610) | 1346610..1346873 | + | 264 | WP_003232653.1 | phage holin | - |
| NVS73_RS07080 (1346886) | 1346886..1347779 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NVS73_RS07085 (1347816) | 1347816..1347953 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| NVS73_RS07090 (1348039) | 1348039..1348209 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| NVS73_RS07095 (1348209) | 1348209..1348955 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| NVS73_RS07100 (1349065) | 1349065..1350066 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| NVS73_RS07105 (1350079) | 1350079..1350696 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| NVS73_RS07110 (1350972) | 1350972..1352288 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
| NVS73_RS07115 (1352677) | 1352677..1353627 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| NVS73_RS07120 (1353728) | 1353728..1353874 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T254164 WP_003244695.1 NZ_CP102769:c1348955-1348209 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|