Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 17021..17549 Replicon plasmid pAOR07BL-2
Accession NZ_CP102764
Organism Acinetobacter baumannii strain AOR07-BL

Toxin (Protein)


Gene name relE Uniprot ID N9N871
Locus tag NU955_RS18980 Protein ID WP_000221358.1
Coordinates 17256..17549 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID N9NWT9
Locus tag NU955_RS18975 Protein ID WP_000246755.1
Coordinates 17021..17266 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU955_RS18950 12223..12951 - 729 WP_032073130.1 efflux system response regulator transcription factor AdeR -
NU955_RS18955 13332..13643 + 312 WP_063454728.1 BrnT family toxin -
NU955_RS18960 13606..13920 + 315 WP_038350244.1 BrnA antitoxin family protein -
NU955_RS18965 14090..14974 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
NU955_RS18970 15030..16505 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
NU955_RS18975 17021..17266 + 246 WP_000246755.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NU955_RS18980 17256..17549 + 294 WP_000221358.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NU955_RS18985 17761..18465 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NU955_RS18990 18589..19092 + 504 Protein_17 Tn3 family transposase -
NU955_RS18995 19202..19906 - 705 WP_001067790.1 IS6-like element IS1008 family transposase -
NU955_RS19000 19984..20856 - 873 Protein_19 exodeoxyribonuclease VII large subunit -
NU955_RS19005 21073..22377 + 1305 WP_000816116.1 HipA domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId - 1..87371 87371
- inside IScluster/Tn mph(E) / msr(E) - 14090..19906 5816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-72)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11292.52 Da        Isoelectric Point: 10.4753

>T254161 WP_000221358.1 NZ_CP102764:17256-17549 [Acinetobacter baumannii]
MTYKLLRHKDFTAEWEKLPVAIRDQFKKKLAKVIEQPHIPKNMLRGDLAGCYKIKLLKAGVRLVYQVKDDQVVILLITVG
KRADSIVYDEAKKRIKD

Download         Length: 294 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9249.64 Da        Isoelectric Point: 4.3142

>AT254161 WP_000246755.1 NZ_CP102764:17021-17266 [Acinetobacter baumannii]
MATVNFRIDEALKEKSYSILKEQGIAPTDFFTSILEYVATTGKLPVKKALLSEEDEELLALVRKRINDPKEMFEEVTLDD
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6A1RKP4

Antitoxin

Source ID Structure
AlphaFold DB A0A6A1RJ80

References