Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2473363..2473885 | Replicon | chromosome |
| Accession | NZ_CP102756 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky isolate AH19MCS11 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | NWA04_RS11985 | Protein ID | WP_000221345.1 |
| Coordinates | 2473363..2473647 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NWA04_RS11990 | Protein ID | WP_000885424.1 |
| Coordinates | 2473637..2473885 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWA04_RS11965 (2469438) | 2469438..2470946 | - | 1509 | WP_023223898.1 | FAD-dependent oxidoreductase | - |
| NWA04_RS11970 (2470991) | 2470991..2471479 | + | 489 | WP_023223899.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NWA04_RS11975 (2471672) | 2471672..2472751 | + | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NWA04_RS11980 (2472803) | 2472803..2473192 | - | 390 | WP_000194089.1 | RidA family protein | - |
| NWA04_RS11985 (2473363) | 2473363..2473647 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NWA04_RS11990 (2473637) | 2473637..2473885 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NWA04_RS11995 (2474037) | 2474037..2474156 | + | 120 | Protein_2329 | type II and III secretion system | - |
| NWA04_RS12000 (2474242) | 2474242..2474573 | + | 332 | Protein_2330 | DUF1493 family protein | - |
| NWA04_RS12005 (2474846) | 2474846..2475754 | + | 909 | WP_077906523.1 | hypothetical protein | - |
| NWA04_RS12010 (2475756) | 2475756..2476495 | - | 740 | Protein_2332 | hypothetical protein | - |
| NWA04_RS12015 (2476727) | 2476727..2476993 | - | 267 | WP_171847526.1 | hypothetical protein | - |
| NWA04_RS12020 (2477186) | 2477186..2477374 | - | 189 | WP_003033726.1 | hypothetical protein | - |
| NWA04_RS12025 (2477498) | 2477498..2478613 | + | 1116 | WP_058670966.1 | phage/plasmid replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T254148 WP_000221345.1 NZ_CP102756:c2473647-2473363 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |