Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1480215..1480835 | Replicon | chromosome |
Accession | NZ_CP102756 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky isolate AH19MCS11 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NWA04_RS07080 | Protein ID | WP_001280991.1 |
Coordinates | 1480215..1480433 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NWA04_RS07085 | Protein ID | WP_000344807.1 |
Coordinates | 1480461..1480835 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWA04_RS07040 (1475438) | 1475438..1476007 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
NWA04_RS07045 (1476040) | 1476040..1476429 | - | 390 | WP_023224410.1 | MGMT family protein | - |
NWA04_RS07055 (1476660) | 1476660..1478210 | - | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NWA04_RS07060 (1478435) | 1478435..1478695 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NWA04_RS07065 (1478701) | 1478701..1478841 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NWA04_RS07070 (1478897) | 1478897..1479367 | - | 471 | WP_000136183.1 | YlaC family protein | - |
NWA04_RS07075 (1479485) | 1479485..1480036 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NWA04_RS07080 (1480215) | 1480215..1480433 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NWA04_RS07085 (1480461) | 1480461..1480835 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NWA04_RS07090 (1481331) | 1481331..1484480 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NWA04_RS07095 (1484503) | 1484503..1485696 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T254147 WP_001280991.1 NZ_CP102756:c1480433-1480215 [Salmonella enterica subsp. enterica serovar Kentucky]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT254147 WP_000344807.1 NZ_CP102756:c1480835-1480461 [Salmonella enterica subsp. enterica serovar Kentucky]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|