Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
| Location | 4416279..4417118 | Replicon | chromosome |
| Accession | NZ_CP102749 | ||
| Organism | Pectobacterium parvum strain YT22221 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A6P1S3C2 |
| Locus tag | NV347_RS19905 | Protein ID | WP_039482128.1 |
| Coordinates | 4416279..4416641 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NV347_RS19910 | Protein ID | WP_039482130.1 |
| Coordinates | 4416645..4417118 (+) | Length | 158 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV347_RS19885 (NV347_19885) | 4411647..4412381 | - | 735 | WP_165708412.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
| NV347_RS19890 (NV347_19890) | 4412391..4413458 | - | 1068 | WP_039512782.1 | type I-E CRISPR-associated protein Cas7/Cse4/CasC | - |
| NV347_RS19895 (NV347_19895) | 4413462..4414109 | - | 648 | WP_039482124.1 | type I-E CRISPR-associated protein Cse2/CasB | - |
| NV347_RS19900 (NV347_19900) | 4414102..4415664 | - | 1563 | WP_039482127.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
| NV347_RS19905 (NV347_19905) | 4416279..4416641 | + | 363 | WP_039482128.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NV347_RS19910 (NV347_19910) | 4416645..4417118 | + | 474 | WP_039482130.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NV347_RS19915 (NV347_19915) | 4417108..4419825 | - | 2718 | WP_052012030.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
| NV347_RS19920 (NV347_19920) | 4419857..4420408 | - | 552 | WP_039482132.1 | polymer-forming cytoskeletal protein | - |
| NV347_RS19925 (NV347_19925) | 4420578..4420766 | - | 189 | WP_039482134.1 | hypothetical protein | - |
| NV347_RS19930 (NV347_19930) | 4421091..4422014 | + | 924 | WP_165708413.1 | aminoimidazole riboside kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4407078..4417118 | 10040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14134.36 Da Isoelectric Point: 9.7305
>T254139 WP_039482128.1 NZ_CP102749:4416279-4416641 [Pectobacterium parvum]
MRVISAKAITDAMKKHAKWKVGLKLWLDVFDKPSLRFESYEQLCHVWRNTSCWNVDRIPFALLENESRKGPLDIYVFDIN
GNSCRIIAWLNPNTGSLYVKDVCSHAEYDKWWKAQTKTKR
MRVISAKAITDAMKKHAKWKVGLKLWLDVFDKPSLRFESYEQLCHVWRNTSCWNVDRIPFALLENESRKGPLDIYVFDIN
GNSCRIIAWLNPNTGSLYVKDVCSHAEYDKWWKAQTKTKR
Download Length: 363 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17776.06 Da Isoelectric Point: 4.2547
>AT254139 WP_039482130.1 NZ_CP102749:4416645-4417118 [Pectobacterium parvum]
MRNTSLGSNSSVGISGLIENLPLLLQEASEQLNSLSVLLSACMEPIEDDNDLQERMECINQLYLYSSDVNHIPATFAELI
ADRVYEYEKKNRDVPHVSQAEALAFFIEERGLKQSDLKQIATQSVISDIINGKRTMTLQQVKDFSRYFNVPIETFID
MRNTSLGSNSSVGISGLIENLPLLLQEASEQLNSLSVLLSACMEPIEDDNDLQERMECINQLYLYSSDVNHIPATFAELI
ADRVYEYEKKNRDVPHVSQAEALAFFIEERGLKQSDLKQIATQSVISDIINGKRTMTLQQVKDFSRYFNVPIETFID
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|