Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4048526..4049076 | Replicon | chromosome |
Accession | NZ_CP102749 | ||
Organism | Pectobacterium parvum strain YT22221 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NV347_RS18255 | Protein ID | WP_039513069.1 |
Coordinates | 4048768..4049076 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | NV347_RS18250 | Protein ID | WP_052237773.1 |
Coordinates | 4048526..4048765 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV347_RS18225 (NV347_18225) | 4043876..4044187 | - | 312 | WP_103160829.1 | AzlD domain-containing protein | - |
NV347_RS18230 (NV347_18230) | 4044184..4044918 | - | 735 | WP_103160830.1 | AzlC family ABC transporter permease | - |
NV347_RS18235 (NV347_18235) | 4045146..4045982 | - | 837 | WP_039513064.1 | AraC family transcriptional regulator | - |
NV347_RS18240 (NV347_18240) | 4046201..4047820 | - | 1620 | WP_039513065.1 | methyl-accepting chemotaxis protein | - |
NV347_RS18245 (NV347_18245) | 4048266..4048451 | - | 186 | WP_039513067.1 | hypothetical protein | - |
NV347_RS18250 (NV347_18250) | 4048526..4048765 | + | 240 | WP_052237773.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NV347_RS18255 (NV347_18255) | 4048768..4049076 | + | 309 | WP_039513069.1 | CcdB family protein | Toxin |
NV347_RS18260 (NV347_18260) | 4049219..4049383 | - | 165 | WP_039513071.1 | glucose uptake inhibitor SgrT | - |
NV347_RS18265 (NV347_18265) | 4049474..4051132 | + | 1659 | WP_039513074.1 | HTH-type transcriptional regulator SgrR | - |
NV347_RS18270 (NV347_18270) | 4051350..4052330 | + | 981 | WP_165708211.1 | thiamine ABC transporter substrate binding subunit | - |
NV347_RS18275 (NV347_18275) | 4052306..4053913 | + | 1608 | WP_039513077.1 | thiamine/thiamine pyrophosphate ABC transporter permease ThiP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11766.60 Da Isoelectric Point: 9.3356
>T254136 WP_039513069.1 NZ_CP102749:4048768-4049076 [Pectobacterium parvum]
MQYKVYRNNGNSNSYPYLLNVQSDIIGELHTRLVIPLFPLNKVARPPARRLTPIVTVEGNDYLIMTHEMASVRRSQLGHE
VMDAQMYRKTIKDAVDFLLDGF
MQYKVYRNNGNSNSYPYLLNVQSDIIGELHTRLVIPLFPLNKVARPPARRLTPIVTVEGNDYLIMTHEMASVRRSQLGHE
VMDAQMYRKTIKDAVDFLLDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|