Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 3855168..3855694 | Replicon | chromosome |
| Accession | NZ_CP102749 | ||
| Organism | Pectobacterium parvum strain YT22221 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | NV347_RS17405 | Protein ID | WP_258210282.1 |
| Coordinates | 3855389..3855694 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | C6C380 |
| Locus tag | NV347_RS17400 | Protein ID | WP_015855076.1 |
| Coordinates | 3855168..3855386 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV347_RS17370 (NV347_17370) | 3850504..3850635 | - | 132 | WP_258210277.1 | hypothetical protein | - |
| NV347_RS17380 (NV347_17380) | 3851380..3852639 | + | 1260 | WP_258210278.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NV347_RS17385 (NV347_17385) | 3852745..3852939 | - | 195 | WP_258210279.1 | YlcI/YnfO family protein | - |
| NV347_RS17390 (NV347_17390) | 3853125..3853466 | + | 342 | WP_258210280.1 | hypothetical protein | - |
| NV347_RS17395 (NV347_17395) | 3854366..3855109 | + | 744 | WP_258210281.1 | MobC family replication-relaxation protein | - |
| NV347_RS17400 (NV347_17400) | 3855168..3855386 | + | 219 | WP_015855076.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NV347_RS17405 (NV347_17405) | 3855389..3855694 | + | 306 | WP_258210282.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NV347_RS17410 (NV347_17410) | 3855848..3858220 | - | 2373 | WP_258210283.1 | AAA family ATPase | - |
| NV347_RS17415 (NV347_17415) | 3858213..3858932 | - | 720 | WP_258210284.1 | hypothetical protein | - |
| NV347_RS17420 (NV347_17420) | 3858929..3860362 | - | 1434 | WP_258210285.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3851203..3861074 | 9871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11771.66 Da Isoelectric Point: 4.5468
>T254135 WP_258210282.1 NZ_CP102749:3855389-3855694 [Pectobacterium parvum]
MQFIVYEYKRTSNYKMFVDVQSDIVETPKRRMVIPLTEAHHLSEKVNKMLFPLIRIDAEDYRLMTTELSSVPVEVIGEAI
ADLGEYADEIKDAINLMFWGI
MQFIVYEYKRTSNYKMFVDVQSDIVETPKRRMVIPLTEAHHLSEKVNKMLFPLIRIDAEDYRLMTTELSSVPVEVIGEAI
ADLGEYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|