Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1845597..1846150 | Replicon | chromosome |
Accession | NZ_CP102749 | ||
Organism | Pectobacterium parvum strain YT22221 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NV347_RS08140 | Protein ID | WP_039504530.1 |
Coordinates | 1845836..1846150 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | C6CEY1 |
Locus tag | NV347_RS08135 | Protein ID | WP_012769207.1 |
Coordinates | 1845597..1845833 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV347_RS08120 (NV347_08120) | 1842292..1843239 | + | 948 | WP_039504525.1 | hypothetical protein | - |
NV347_RS08125 (NV347_08125) | 1843309..1843812 | + | 504 | WP_131547303.1 | hypothetical protein | - |
NV347_RS08130 (NV347_08130) | 1844333..1845277 | + | 945 | WP_039504528.1 | zincin-like metallopeptidase domain-containing protein | - |
NV347_RS08135 (NV347_08135) | 1845597..1845833 | + | 237 | WP_012769207.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NV347_RS08140 (NV347_08140) | 1845836..1846150 | + | 315 | WP_039504530.1 | CcdB family protein | Toxin |
NV347_RS08145 (NV347_08145) | 1846543..1847547 | - | 1005 | WP_039504532.1 | DUF4238 domain-containing protein | - |
NV347_RS08150 (NV347_08150) | 1847650..1848636 | - | 987 | WP_052326018.1 | DUF2971 domain-containing protein | - |
NV347_RS08155 (NV347_08155) | 1848906..1849652 | - | 747 | WP_039504534.1 | MobC family replication-relaxation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1837123..1875860 | 38737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11595.59 Da Isoelectric Point: 7.9859
>T254132 WP_039504530.1 NZ_CP102749:1845836-1846150 [Pectobacterium parvum]
MQFTVYGNTGKSVVYPLLLDVTSDIIRQLNRRIVIPLLPIEKYPAGRRPDRLVPVVMLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRSQVKAAIDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIRQLNRRIVIPLLPIEKYPAGRRPDRLVPVVMLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRSQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|