Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1425975..1426600 | Replicon | chromosome |
| Accession | NZ_CP102749 | ||
| Organism | Pectobacterium parvum strain YT22221 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | C6DB72 |
| Locus tag | NV347_RS06300 | Protein ID | WP_005976087.1 |
| Coordinates | 1425975..1426178 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A6P1S9D7 |
| Locus tag | NV347_RS06305 | Protein ID | WP_039487867.1 |
| Coordinates | 1426232..1426600 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV347_RS06270 (NV347_06270) | 1421431..1421769 | + | 339 | WP_039485501.1 | P-II family nitrogen regulator | - |
| NV347_RS06275 (NV347_06275) | 1421809..1423095 | + | 1287 | WP_039485503.1 | ammonium transporter AmtB | - |
| NV347_RS06280 (NV347_06280) | 1423231..1424094 | - | 864 | WP_039485505.1 | acyl-CoA thioesterase II | - |
| NV347_RS06285 (NV347_06285) | 1424306..1424887 | + | 582 | WP_039485508.1 | YbaY family lipoprotein | - |
| NV347_RS06290 (NV347_06290) | 1424907..1425227 | - | 321 | WP_010282239.1 | MGMT family protein | - |
| NV347_RS06300 (NV347_06300) | 1425975..1426178 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
| NV347_RS06305 (NV347_06305) | 1426232..1426600 | - | 369 | WP_039487867.1 | Hha toxicity modulator TomB | Antitoxin |
| NV347_RS06310 (NV347_06310) | 1427198..1427341 | - | 144 | WP_072012464.1 | type B 50S ribosomal protein L36 | - |
| NV347_RS06315 (NV347_06315) | 1427359..1427607 | - | 249 | WP_015839361.1 | type B 50S ribosomal protein L31 | - |
| NV347_RS06320 (NV347_06320) | 1427794..1430922 | - | 3129 | WP_039487869.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T254131 WP_005976087.1 NZ_CP102749:c1426178-1425975 [Pectobacterium parvum]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14013.72 Da Isoelectric Point: 4.4776
>AT254131 WP_039487867.1 NZ_CP102749:c1426600-1426232 [Pectobacterium parvum]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRHWQKSKAKLFGMFSGENVCTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRHWQKSKAKLFGMFSGENVCTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D7Z3F0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1S9D7 |