Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1077954..1078479 | Replicon | chromosome |
| Accession | NZ_CP102749 | ||
| Organism | Pectobacterium parvum strain YT22221 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NV347_RS04760 | Protein ID | WP_039486183.1 |
| Coordinates | 1077954..1078238 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C6D956 |
| Locus tag | NV347_RS04765 | Protein ID | WP_005973616.1 |
| Coordinates | 1078228..1078479 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV347_RS04745 (NV347_04745) | 1074234..1075373 | + | 1140 | WP_010681611.1 | glycoside hydrolase family 88 protein | - |
| NV347_RS04750 (NV347_04750) | 1075745..1076491 | - | 747 | WP_039486185.1 | SDR family oxidoreductase | - |
| NV347_RS04755 (NV347_04755) | 1077204..1077770 | + | 567 | WP_039513221.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
| NV347_RS04760 (NV347_04760) | 1077954..1078238 | - | 285 | WP_039486183.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NV347_RS04765 (NV347_04765) | 1078228..1078479 | - | 252 | WP_005973616.1 | prevent-host-death protein | Antitoxin |
| NV347_RS04770 (NV347_04770) | 1078741..1081068 | - | 2328 | WP_258210331.1 | phage/plasmid primase, P4 family | - |
| NV347_RS04775 (NV347_04775) | 1081079..1081420 | - | 342 | WP_111778900.1 | DUF5375 family protein | - |
| NV347_RS04780 (NV347_04780) | 1081417..1081683 | - | 267 | WP_103160155.1 | hypothetical protein | - |
| NV347_RS04785 (NV347_04785) | 1081680..1081874 | - | 195 | WP_005973630.1 | hypothetical protein | - |
| NV347_RS04790 (NV347_04790) | 1081867..1082064 | - | 198 | WP_121266703.1 | host cell division inhibitor Icd-like protein | - |
| NV347_RS04795 (NV347_04795) | 1082100..1082411 | - | 312 | Protein_927 | ash family protein | - |
| NV347_RS04800 (NV347_04800) | 1082420..1082644 | - | 225 | WP_015841426.1 | hypothetical protein | - |
| NV347_RS04805 (NV347_04805) | 1082641..1082865 | - | 225 | WP_165707587.1 | AlpA family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11010.02 Da Isoelectric Point: 10.3917
>T254130 WP_039486183.1 NZ_CP102749:c1078238-1077954 [Pectobacterium parvum]
MSYKLEFEEHALKEFKKLGAPVREQFTKKLKEVLQNPHVPANRLHGMADCYKIKLRSAGYRLVYQVIKHEIVVLVLAVGK
RERSEVYKTAKDRL
MSYKLEFEEHALKEFKKLGAPVREQFTKKLKEVLQNPHVPANRLHGMADCYKIKLRSAGYRLVYQVIKHEIVVLVLAVGK
RERSEVYKTAKDRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|