Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 772888..773548 | Replicon | chromosome |
Accession | NZ_CP102749 | ||
Organism | Pectobacterium parvum strain YT22221 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A093S6F1 |
Locus tag | NV347_RS03480 | Protein ID | WP_039487287.1 |
Coordinates | 773135..773548 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A093SCR9 |
Locus tag | NV347_RS03475 | Protein ID | WP_039487284.1 |
Coordinates | 772888..773154 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV347_RS03455 (NV347_03455) | 768744..769748 | - | 1005 | WP_039487278.1 | substrate-binding domain-containing protein | - |
NV347_RS03460 (NV347_03460) | 769803..770411 | - | 609 | WP_039487279.1 | HD domain-containing protein | - |
NV347_RS03465 (NV347_03465) | 770812..771459 | + | 648 | WP_039487281.1 | hemolysin III family protein | - |
NV347_RS03470 (NV347_03470) | 771651..772652 | - | 1002 | WP_039487282.1 | tRNA-modifying protein YgfZ | - |
NV347_RS03475 (NV347_03475) | 772888..773154 | + | 267 | WP_039487284.1 | FAD assembly factor SdhE | Antitoxin |
NV347_RS03480 (NV347_03480) | 773135..773548 | + | 414 | WP_039487287.1 | protein YgfX | Toxin |
NV347_RS03485 (NV347_03485) | 773617..774552 | + | 936 | WP_039487289.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
NV347_RS03490 (NV347_03490) | 774618..774941 | - | 324 | WP_039487292.1 | hypothetical protein | - |
NV347_RS03495 (NV347_03495) | 774970..775488 | - | 519 | WP_039487295.1 | flavodoxin FldB | - |
NV347_RS03500 (NV347_03500) | 775820..776206 | - | 387 | WP_039282122.1 | thioesterase family protein | - |
NV347_RS03505 (NV347_03505) | 776431..777753 | - | 1323 | WP_039487297.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16297.28 Da Isoelectric Point: 10.6913
>T254129 WP_039487287.1 NZ_CP102749:773135-773548 [Pectobacterium parvum]
VAQWQCDLRVSWRMQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQKNIKSRQGEIVLLSETTLNWRQQ
EWQIVKRPWLLKNGVLLSLRAVNGKDKQQLWLASDSMGDEEWRHLRQLLLQQKHWAR
VAQWQCDLRVSWRMQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQKNIKSRQGEIVLLSETTLNWRQQ
EWQIVKRPWLLKNGVLLSLRAVNGKDKQQLWLASDSMGDEEWRHLRQLLLQQKHWAR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A093S6F1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A093SCR9 |