Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1454822..1455491 | Replicon | chromosome |
| Accession | NZ_CP102747 | ||
| Organism | Streptococcus parasuis strain SFJ45 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | G7SGM1 |
| Locus tag | NWE22_RS07420 | Protein ID | WP_014637653.1 |
| Coordinates | 1455309..1455491 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NWE22_RS07415 | Protein ID | WP_239604090.1 |
| Coordinates | 1454822..1455271 (-) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWE22_RS07400 (NWE22_07400) | 1449953..1452415 | - | 2463 | WP_277745330.1 | heavy metal translocating P-type ATPase | - |
| NWE22_RS07405 (NWE22_07405) | 1452510..1453367 | - | 858 | WP_277745331.1 | SAM-dependent methyltransferase TehB | - |
| NWE22_RS07410 (NWE22_07410) | 1453620..1454663 | + | 1044 | WP_277745332.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| NWE22_RS07415 (NWE22_07415) | 1454822..1455271 | - | 450 | WP_239604090.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NWE22_RS07420 (NWE22_07420) | 1455309..1455491 | - | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NWE22_RS07425 (NWE22_07425) | 1455905..1456372 | - | 468 | WP_277745333.1 | SsrA-binding protein SmpB | - |
| NWE22_RS07430 (NWE22_07430) | 1456375..1458744 | - | 2370 | WP_277745334.1 | ribonuclease R | - |
| NWE22_RS07435 (NWE22_07435) | 1459008..1459241 | - | 234 | WP_171989834.1 | preprotein translocase subunit SecG | - |
| NWE22_RS07440 (NWE22_07440) | 1459288..1459437 | - | 150 | WP_012775228.1 | 50S ribosomal protein L33 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T254118 WP_014637653.1 NZ_CP102747:c1455491-1455309 [Streptococcus parasuis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16620.60 Da Isoelectric Point: 3.9788
>AT254118 WP_239604090.1 NZ_CP102747:c1455271-1454822 [Streptococcus parasuis]
MLVTYPALFYFDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGMNLADYIENGRDIPTPSSINTLSLVDNNPF
HDEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYFDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGMNLADYIENGRDIPTPSSINTLSLVDNNPF
HDEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|