Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1409378..1409864 Replicon chromosome
Accession NZ_CP102747
Organism Streptococcus parasuis strain SFJ45

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NWE22_RS07215 Protein ID WP_105127516.1
Coordinates 1409378..1409647 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NWE22_RS07220 Protein ID WP_130554954.1
Coordinates 1409637..1409864 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE22_RS07180 (NWE22_07180) 1404496..1405470 - 975 WP_274512952.1 YvcK family protein -
NWE22_RS07185 (NWE22_07185) 1405467..1406354 - 888 WP_277745295.1 RNase adapter RapZ -
NWE22_RS07190 (NWE22_07190) 1406377..1406757 - 381 WP_130554943.1 RidA family protein -
NWE22_RS07195 (NWE22_07195) 1406807..1408126 - 1320 WP_277745296.1 MATE family efflux transporter -
NWE22_RS07200 (NWE22_07200) 1408421..1408624 - 204 WP_277745297.1 LPXTG cell wall anchor domain-containing protein -
NWE22_RS07205 (NWE22_07205) 1408605..1408943 - 339 WP_171989763.1 type II toxin-antitoxin system RelE/ParE family toxin -
NWE22_RS07210 (NWE22_07210) 1408943..1409230 - 288 WP_130554939.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
NWE22_RS07215 (NWE22_07215) 1409378..1409647 - 270 WP_105127516.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE22_RS07220 (NWE22_07220) 1409637..1409864 - 228 WP_130554954.1 DUF6290 family protein Antitoxin
NWE22_RS07225 (NWE22_07225) 1410202..1411548 - 1347 WP_277745298.1 asparagine--tRNA ligase -
NWE22_RS07230 (NWE22_07230) 1411563..1412744 - 1182 WP_277745299.1 pyridoxal phosphate-dependent aminotransferase -
NWE22_RS07235 (NWE22_07235) 1412741..1413238 - 498 WP_277745300.1 DUF5590 domain-containing protein -
NWE22_RS07240 (NWE22_07240) 1413385..1413825 + 441 WP_277745301.1 MarR family transcriptional regulator -
NWE22_RS07245 (NWE22_07245) 1413901..1414413 + 513 WP_277745302.1 NAD(P)H-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10469.51 Da        Isoelectric Point: 10.4241

>T254117 WP_105127516.1 NZ_CP102747:c1409647-1409378 [Streptococcus parasuis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEM
GHRKDIYRK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8522.62 Da        Isoelectric Point: 4.1707

>AT254117 WP_130554954.1 NZ_CP102747:c1409864-1409637 [Streptococcus parasuis]
MGIVSLRLNETEEEIFRSYAIHTGKSLSELFKSALIEQIEDQLDYEIGIKALKKFQENPVTHSIDDVLAELEDGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References