Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-parD/RelE-RelB |
| Location | 1408943..1409647 | Replicon | chromosome |
| Accession | NZ_CP102747 | ||
| Organism | Streptococcus parasuis strain SFJ45 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NWE22_RS07215 | Protein ID | WP_105127516.1 |
| Coordinates | 1409378..1409647 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | NWE22_RS07210 | Protein ID | WP_130554939.1 |
| Coordinates | 1408943..1409230 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWE22_RS07180 (NWE22_07180) | 1404496..1405470 | - | 975 | WP_274512952.1 | YvcK family protein | - |
| NWE22_RS07185 (NWE22_07185) | 1405467..1406354 | - | 888 | WP_277745295.1 | RNase adapter RapZ | - |
| NWE22_RS07190 (NWE22_07190) | 1406377..1406757 | - | 381 | WP_130554943.1 | RidA family protein | - |
| NWE22_RS07195 (NWE22_07195) | 1406807..1408126 | - | 1320 | WP_277745296.1 | MATE family efflux transporter | - |
| NWE22_RS07200 (NWE22_07200) | 1408421..1408624 | - | 204 | WP_277745297.1 | LPXTG cell wall anchor domain-containing protein | - |
| NWE22_RS07205 (NWE22_07205) | 1408605..1408943 | - | 339 | WP_171989763.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NWE22_RS07210 (NWE22_07210) | 1408943..1409230 | - | 288 | WP_130554939.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NWE22_RS07215 (NWE22_07215) | 1409378..1409647 | - | 270 | WP_105127516.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NWE22_RS07220 (NWE22_07220) | 1409637..1409864 | - | 228 | WP_130554954.1 | DUF6290 family protein | - |
| NWE22_RS07225 (NWE22_07225) | 1410202..1411548 | - | 1347 | WP_277745298.1 | asparagine--tRNA ligase | - |
| NWE22_RS07230 (NWE22_07230) | 1411563..1412744 | - | 1182 | WP_277745299.1 | pyridoxal phosphate-dependent aminotransferase | - |
| NWE22_RS07235 (NWE22_07235) | 1412741..1413238 | - | 498 | WP_277745300.1 | DUF5590 domain-containing protein | - |
| NWE22_RS07240 (NWE22_07240) | 1413385..1413825 | + | 441 | WP_277745301.1 | MarR family transcriptional regulator | - |
| NWE22_RS07245 (NWE22_07245) | 1413901..1414413 | + | 513 | WP_277745302.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10469.51 Da Isoelectric Point: 10.4241
>T254116 WP_105127516.1 NZ_CP102747:c1409647-1409378 [Streptococcus parasuis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEM
GHRKDIYRK
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEM
GHRKDIYRK
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|