Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1059279..1059765 Replicon chromosome
Accession NZ_CP102747
Organism Streptococcus parasuis strain SFJ45

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NWE22_RS05385 Protein ID WP_277745737.1
Coordinates 1059279..1059485 (-) Length 69 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NWE22_RS05390 Protein ID WP_277745218.1
Coordinates 1059526..1059765 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE22_RS05365 (NWE22_05370) 1054656..1055726 + 1071 WP_277745215.1 tyrosine recombinase XerS -
NWE22_RS05370 (NWE22_05375) 1055945..1057453 - 1509 WP_277745216.1 phosphomannomutase/phosphoglucomutase -
NWE22_RS05375 (NWE22_05380) 1057634..1058575 - 942 WP_277745217.1 sensor histidine kinase -
NWE22_RS05380 (NWE22_05385) 1058572..1059240 - 669 WP_171988476.1 response regulator transcription factor -
NWE22_RS05385 (NWE22_05390) 1059279..1059485 - 207 WP_277745737.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE22_RS05390 (NWE22_05395) 1059526..1059765 - 240 WP_277745218.1 DUF6290 family protein Antitoxin
NWE22_RS05395 (NWE22_05400) 1059856..1061826 - 1971 WP_277745219.1 ABC transporter permease -
NWE22_RS05400 (NWE22_05405) 1061827..1062579 - 753 WP_174845939.1 ABC transporter ATP-binding protein -
NWE22_RS05405 (NWE22_05410) 1062588..1062977 - 390 WP_171988481.1 NisI/SpaI family lantibiotic immunity lipoprotein -
NWE22_RS05410 (NWE22_05415) 1062990..1063130 - 141 WP_171988482.1 hypothetical protein -
NWE22_RS05415 (NWE22_05420) 1063269..1064435 - 1167 WP_274513078.1 ATP-grasp domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Protein of unknown function DUF6290

(1-75)


Sequences

Toxin        


Download         Length: 69 a.a.        Molecular weight: 7821.98 Da        Isoelectric Point: 10.2404

>T254114 WP_277745737.1 NZ_CP102747:c1059485-1059279 [Streptococcus parasuis]
MDKTAASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVSIEDDKVTVTSLKMRNGSI

Download         Length: 207 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8822.03 Da        Isoelectric Point: 3.7832

>AT254114 WP_277745218.1 NZ_CP102747:c1059765-1059526 [Streptococcus parasuis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADIALAEYQEDLSNGIEPITLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References