Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 156565..156959 Replicon chromosome
Accession NZ_CP102747
Organism Streptococcus parasuis strain SFJ45

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NWE22_RS00850 Protein ID WP_239604456.1
Coordinates 156789..156959 (+) Length 57 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag NWE22_RS00845 Protein ID WP_275577031.1
Coordinates 156565..156693 (+) Length 43 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE22_RS00810 (NWE22_00810) 151622..151981 + 360 WP_174846592.1 ribonuclease P protein component -
NWE22_RS00815 (NWE22_00815) 151965..152777 + 813 WP_174846591.1 YidC/Oxa1 family membrane protein insertase -
NWE22_RS00820 (NWE22_00820) 152796..153800 + 1005 WP_239604455.1 RNA-binding cell elongation regulator Jag/EloR -
NWE22_RS00825 (NWE22_00825) 154022..154159 + 138 WP_049618373.1 50S ribosomal protein L34 -
NWE22_RS00830 (NWE22_00830) 154209..155090 - 882 WP_174846590.1 diacylglycerol kinase family lipid kinase -
NWE22_RS00835 (NWE22_00835) 155240..156022 + 783 WP_171988962.1 TatD family hydrolase -
NWE22_RS00840 (NWE22_00840) 156006..156572 + 567 WP_171989046.1 ribonuclease M5 -
NWE22_RS00845 (NWE22_00845) 156565..156693 + 129 WP_275577031.1 hypothetical protein Antitoxin
NWE22_RS00850 (NWE22_00850) 156789..156959 + 171 WP_239604456.1 hypothetical protein Toxin
NWE22_RS00855 (NWE22_00855) 156966..157218 + 253 Protein_147 NUDIX domain-containing protein -
NWE22_RS00860 (NWE22_00860) 157257..158129 + 873 WP_171988961.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NWE22_RS00865 (NWE22_00865) 159375..160115 + 741 WP_171988960.1 amino acid transporter -
NWE22_RS00870 (NWE22_00870) 160125..160703 + 579 WP_239604458.1 CPBP family intramembrane metalloprotease -
NWE22_RS00875 (NWE22_00875) 160715..161143 + 429 WP_171988959.1 Msa family membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 138774..158129 19355


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 57 a.a.        Molecular weight: 6555.70 Da        Isoelectric Point: 10.3173

>T254113 WP_239604456.1 NZ_CP102747:156789-156959 [Streptococcus parasuis]
MSFNADNRFGKQIDPLHLTRGYVIGKDYIALYRVVKNELRVVHLFATKSDYVKLLK

Download         Length: 171 bp

Antitoxin


Download         Length: 43 a.a.        Molecular weight: 4753.45 Da        Isoelectric Point: 3.7141

>AT254113 WP_275577031.1 NZ_CP102747:156565-156693 [Streptococcus parasuis]
MSELETGKEVFAMNQLDLTASFNLILQNIAVKNELLILTEEE

Download         Length: 129 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References