Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1900407..1901013 Replicon chromosome
Accession NZ_CP102746
Organism Streptococcus suis strain Transconjugant cAKJ47-2

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag NWE23_RS09275 Protein ID WP_012775364.1
Coordinates 1900407..1900736 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag NWE23_RS09280 Protein ID WP_012028535.1
Coordinates 1900726..1901013 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE23_RS09235 (NWE23_09245) 1895424..1895912 - 489 WP_099875810.1 hypothetical protein -
NWE23_RS09240 (NWE23_09250) 1895990..1896574 - 585 WP_277726181.1 CPBP family intramembrane metalloprotease -
NWE23_RS09245 (NWE23_09255) 1896577..1896810 - 234 WP_014636637.1 hypothetical protein -
NWE23_RS09250 (NWE23_09260) 1896819..1897202 - 384 WP_074390216.1 hypothetical protein -
NWE23_RS09255 (NWE23_09265) 1897213..1897641 - 429 WP_105147505.1 hypothetical protein -
NWE23_RS09260 (NWE23_09270) 1897625..1898980 - 1356 WP_277726182.1 DNA (cytosine-5-)-methyltransferase -
NWE23_RS09265 (NWE23_09275) 1899129..1899947 - 819 WP_208571504.1 replication initiator protein A -
NWE23_RS09270 (NWE23_09280) 1899944..1900117 - 174 WP_208571503.1 hypothetical protein -
NWE23_RS09275 (NWE23_09285) 1900407..1900736 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE23_RS09280 (NWE23_09290) 1900726..1901013 - 288 WP_012028535.1 hypothetical protein Antitoxin
NWE23_RS09285 (NWE23_09295) 1901111..1901479 - 369 WP_012775453.1 hypothetical protein -
NWE23_RS09290 (NWE23_09300) 1901472..1902041 - 570 WP_012775366.1 ribonuclease M5 -
NWE23_RS09295 (NWE23_09305) 1902025..1902807 - 783 WP_012028536.1 TatD family hydrolase -
NWE23_RS09300 (NWE23_09310) 1902914..1903051 - 138 WP_002939016.1 50S ribosomal protein L34 -
NWE23_RS09305 (NWE23_09315) 1903219..1904214 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
NWE23_RS09310 (NWE23_09320) 1904234..1905046 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
NWE23_RS09315 (NWE23_09325) 1905030..1905389 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element optrA - 1826830..1901442 74612


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T254112 WP_012775364.1 NZ_CP102746:c1900736-1900407 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT254112 WP_012028535.1 NZ_CP102746:c1901013-1900726 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References