Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 597095..597581 Replicon chromosome
Accession NZ_CP102746
Organism Streptococcus suis strain Transconjugant cAKJ47-2

Toxin (Protein)


Gene name relE Uniprot ID D5AGV2
Locus tag NWE23_RS02970 Protein ID WP_011922754.1
Coordinates 597312..597581 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D5AGV1
Locus tag NWE23_RS02965 Protein ID WP_002938604.1
Coordinates 597095..597322 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE23_RS02940 (NWE23_02945) 592138..592587 - 450 WP_009909619.1 MarR family transcriptional regulator -
NWE23_RS02945 (NWE23_02950) 592881..593728 + 848 WP_087892711.1 IS630 family transposase -
NWE23_RS02950 (NWE23_02955) 593787..594284 + 498 WP_011922751.1 DUF5590 domain-containing protein -
NWE23_RS02955 (NWE23_02960) 594281..595462 + 1182 WP_011922154.1 pyridoxal phosphate-dependent aminotransferase -
NWE23_RS02960 (NWE23_02965) 595477..596823 + 1347 WP_011922752.1 asparagine--tRNA ligase -
NWE23_RS02965 (NWE23_02970) 597095..597322 + 228 WP_002938604.1 DUF6290 family protein Antitoxin
NWE23_RS02970 (NWE23_02975) 597312..597581 + 270 WP_011922754.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE23_RS02975 (NWE23_02980) 597987..599306 + 1320 WP_012775027.1 MATE family efflux transporter -
NWE23_RS02980 (NWE23_02985) 599357..599734 + 378 WP_002937263.1 RidA family protein -
NWE23_RS02985 (NWE23_02990) 599756..600643 + 888 WP_011922160.1 RNase adapter RapZ -
NWE23_RS02990 (NWE23_02995) 600640..601614 + 975 WP_002937257.1 YvcK family protein -
NWE23_RS02995 (NWE23_03000) 601611..602528 + 918 WP_002937252.1 DNA-binding protein WhiA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10437.49 Da        Isoelectric Point: 10.3916

>T254108 WP_011922754.1 NZ_CP102746:597312-597581 [Streptococcus suis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8450.51 Da        Isoelectric Point: 4.1589

>AT254108 WP_002938604.1 NZ_CP102746:597095-597322 [Streptococcus suis]
MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDYEIGIKALKKFQENPVTHSIDDVLAELEDGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A126UKS2

Antitoxin

Source ID Structure
AlphaFold DB A0A140EXF0

References