Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
| Location | 511351..511865 | Replicon | chromosome |
| Accession | NZ_CP102745 | ||
| Organism | Ornithobacterium rhinotracheale strain IRI-Sh | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NV236_RS02440 | Protein ID | WP_258205062.1 |
| Coordinates | 511351..511608 (-) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | NV236_RS02445 | Protein ID | WP_258204953.1 |
| Coordinates | 511611..511865 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV236_RS02400 (NV236_02400) | 506406..507233 | + | 828 | WP_014791214.1 | 50S ribosomal protein L11 methyltransferase | - |
| NV236_RS02405 (NV236_02405) | 507237..507530 | + | 294 | WP_014791213.1 | ATP-dependent Clp protease adaptor ClpS | - |
| NV236_RS02410 (NV236_02410) | 507545..507958 | + | 414 | WP_155814511.1 | Holliday junction resolvase RuvX | - |
| NV236_RS02415 (NV236_02415) | 508109..508681 | + | 573 | WP_014791211.1 | peptide deformylase | - |
| NV236_RS02420 (NV236_02420) | 508731..509156 | + | 426 | WP_014791210.1 | DUF5606 domain-containing protein | - |
| NV236_RS02425 (NV236_02425) | 509245..510018 | + | 774 | WP_014791209.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NV236_RS02430 (NV236_02430) | 510070..510996 | + | 927 | WP_014791208.1 | J domain-containing protein | - |
| NV236_RS02435 (NV236_02435) | 511002..511295 | + | 294 | WP_014791207.1 | chaperone modulator CbpM | - |
| NV236_RS02440 (NV236_02440) | 511351..511608 | - | 258 | WP_258205062.1 | Txe/YoeB family addiction module toxin | Toxin |
| NV236_RS02445 (NV236_02445) | 511611..511865 | - | 255 | WP_258204953.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NV236_RS02450 (NV236_02450) | 511937..514168 | - | 2232 | WP_258204954.1 | TonB-dependent receptor | - |
| NV236_RS02455 (NV236_02455) | 514149..515516 | - | 1368 | WP_014791203.1 | HTTM domain-containing protein | - |
| NV236_RS02460 (NV236_02460) | 515543..516670 | - | 1128 | WP_014791202.1 | imelysin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10573.14 Da Isoelectric Point: 8.9288
>T254107 WP_258205062.1 NZ_CP102745:c511608-511351 [Ornithobacterium rhinotracheale]
IKYIFVDESWEDYLYWQKNDKRKLKRINALLKDISRTPFEGIGKPEPLKHKYSGFWSRRIDDEHCLIYRYEEDKILIAKC
RFHYD
IKYIFVDESWEDYLYWQKNDKRKLKRINALLKDISRTPFEGIGKPEPLKHKYSGFWSRRIDDEHCLIYRYEEDKILIAKC
RFHYD
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|