Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 78616..79175 Replicon plasmid pYUAHMCS8-1
Accession NZ_CP102740
Organism Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8

Toxin (Protein)


Gene name relE Uniprot ID U9YB49
Locus tag NWA03_RS24165 Protein ID WP_000421259.1
Coordinates 78900..79175 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7Z1D1G5
Locus tag NWA03_RS24160 Protein ID WP_053264324.1
Coordinates 78616..78900 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWA03_RS24140 (74264) 74264..74797 - 534 WP_001372168.1 transcription termination/antitermination NusG family protein -
NWA03_RS24145 (75239) 75239..75526 - 288 WP_000074855.1 conjugal transfer protein TraA -
NWA03_RS24150 (75564) 75564..75722 - 159 Protein_82 ash family protein -
NWA03_RS24155 (76680) 76680..77711 + 1032 WP_000907869.1 plasmid replication initiator RepA -
NWA03_RS24160 (78616) 78616..78900 + 285 WP_053264324.1 ribbon-helix-helix domain-containing protein Antitoxin
NWA03_RS24165 (78900) 78900..79175 + 276 WP_000421259.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWA03_RS24170 (79281) 79281..79562 + 282 WP_001105066.1 hypothetical protein -
NWA03_RS24175 (79754) 79754..80020 - 267 WP_021513970.1 hypothetical protein -
NWA03_RS24180 (80020) 80020..80514 - 495 WP_015058884.1 hypothetical protein -
NWA03_RS24185 (80570) 80570..81172 - 603 WP_000521606.1 ProQ/FINO family protein -
NWA03_RS24190 (81348) 81348..82400 - 1053 WP_000655519.1 hypothetical protein -
NWA03_RS24195 (82613) 82613..83203 - 591 WP_112925504.1 hypothetical protein -
NWA03_RS24200 (83203) 83203..83457 - 255 WP_000343103.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..85309 85309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10736.45 Da        Isoelectric Point: 9.9324

>T254106 WP_000421259.1 NZ_CP102740:78900-79175 [Salmonella enterica subsp. enterica serovar Kentucky]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10502.95 Da        Isoelectric Point: 5.6643

>AT254106 WP_053264324.1 NZ_CP102740:78616-78900 [Salmonella enterica subsp. enterica serovar Kentucky]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWIIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
AESLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YB49

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z1D1G5

References