Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2475872..2476394 | Replicon | chromosome |
| Accession | NZ_CP102739 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | NWA03_RS12020 | Protein ID | WP_000221345.1 |
| Coordinates | 2475872..2476156 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NWA03_RS12025 | Protein ID | WP_000885424.1 |
| Coordinates | 2476146..2476394 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWA03_RS12000 (2471947) | 2471947..2473455 | - | 1509 | WP_023223898.1 | FAD-dependent oxidoreductase | - |
| NWA03_RS12005 (2473500) | 2473500..2473988 | + | 489 | WP_023223899.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NWA03_RS12010 (2474181) | 2474181..2475260 | + | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NWA03_RS12015 (2475312) | 2475312..2475701 | - | 390 | WP_000194089.1 | RidA family protein | - |
| NWA03_RS12020 (2475872) | 2475872..2476156 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NWA03_RS12025 (2476146) | 2476146..2476394 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NWA03_RS12030 (2476546) | 2476546..2476665 | + | 120 | Protein_2334 | type II and III secretion system | - |
| NWA03_RS12035 (2476751) | 2476751..2477082 | + | 332 | Protein_2335 | DUF1493 family protein | - |
| NWA03_RS12040 (2477355) | 2477355..2478263 | + | 909 | WP_077906523.1 | hypothetical protein | - |
| NWA03_RS12045 (2478265) | 2478265..2479004 | - | 740 | Protein_2337 | hypothetical protein | - |
| NWA03_RS12050 (2479370) | 2479370..2479558 | - | 189 | WP_001276021.1 | DUF29 family protein | - |
| NWA03_RS12055 (2479960) | 2479960..2480244 | + | 285 | Protein_2339 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2474181..2485874 | 11693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T254093 WP_000221345.1 NZ_CP102739:c2476156-2475872 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |