Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1482483..1483103 | Replicon | chromosome |
Accession | NZ_CP102739 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NWA03_RS07110 | Protein ID | WP_001280991.1 |
Coordinates | 1482483..1482701 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NWA03_RS07115 | Protein ID | WP_000344807.1 |
Coordinates | 1482729..1483103 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWA03_RS07070 (1477706) | 1477706..1478275 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
NWA03_RS07075 (1478308) | 1478308..1478697 | - | 390 | WP_023224410.1 | MGMT family protein | - |
NWA03_RS07085 (1478928) | 1478928..1480478 | - | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NWA03_RS07090 (1480703) | 1480703..1480963 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NWA03_RS07095 (1480969) | 1480969..1481109 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NWA03_RS07100 (1481165) | 1481165..1481635 | - | 471 | WP_000136183.1 | YlaC family protein | - |
NWA03_RS07105 (1481753) | 1481753..1482304 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NWA03_RS07110 (1482483) | 1482483..1482701 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NWA03_RS07115 (1482729) | 1482729..1483103 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NWA03_RS07120 (1483599) | 1483599..1486748 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NWA03_RS07125 (1486771) | 1486771..1487964 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T254092 WP_001280991.1 NZ_CP102739:c1482701-1482483 [Salmonella enterica subsp. enterica serovar Kentucky]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT254092 WP_000344807.1 NZ_CP102739:c1483103-1482729 [Salmonella enterica subsp. enterica serovar Kentucky]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|