Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 680717..681360 | Replicon | chromosome |
| Accession | NZ_CP102739 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B5F3H8 |
| Locus tag | NWA03_RS03290 | Protein ID | WP_000048134.1 |
| Coordinates | 680717..681133 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | NWA03_RS03295 | Protein ID | WP_001261294.1 |
| Coordinates | 681130..681360 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWA03_RS03270 (675754) | 675754..676887 | + | 1134 | WP_023224151.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| NWA03_RS03275 (676871) | 676871..677989 | + | 1119 | WP_023224150.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NWA03_RS03280 (677986) | 677986..678726 | + | 741 | WP_000779255.1 | KDGP aldolase family protein | - |
| NWA03_RS03285 (678743) | 678743..680656 | + | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
| NWA03_RS03290 (680717) | 680717..681133 | - | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NWA03_RS03295 (681130) | 681130..681360 | - | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NWA03_RS03300 (681528) | 681528..681992 | - | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NWA03_RS03305 (682209) | 682209..684347 | - | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T254088 WP_000048134.1 NZ_CP102739:c681133-680717 [Salmonella enterica subsp. enterica serovar Kentucky]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T8L749 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SIC2 |