Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 542393..543174 | Replicon | chromosome |
Accession | NZ_CP102739 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | NWA03_RS02560 | Protein ID | WP_000625911.1 |
Coordinates | 542683..543174 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | NWA03_RS02555 | Protein ID | WP_001271379.1 |
Coordinates | 542393..542686 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWA03_RS02520 (538693) | 538693..539598 | + | 906 | WP_001268192.1 | YjiK family protein | - |
NWA03_RS02525 (539893) | 539893..540087 | - | 195 | WP_223163373.1 | hypothetical protein | - |
NWA03_RS02530 (540135) | 540135..540234 | - | 100 | Protein_477 | hypothetical protein | - |
NWA03_RS02535 (540254) | 540254..540436 | + | 183 | WP_072106065.1 | ATP-binding cassette domain-containing protein | - |
NWA03_RS02540 (540429) | 540429..540716 | - | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
NWA03_RS02545 (540713) | 540713..541588 | - | 876 | WP_023205266.1 | AraC family transcriptional regulator | - |
NWA03_RS02550 (541854) | 541854..542075 | - | 222 | WP_052939504.1 | hypothetical protein | - |
NWA03_RS02555 (542393) | 542393..542686 | + | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
NWA03_RS02560 (542683) | 542683..543174 | + | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
NWA03_RS02565 (543389) | 543389..543637 | + | 249 | Protein_484 | IS481 family transposase | - |
NWA03_RS02570 (543912) | 543912..544139 | - | 228 | WP_001112992.1 | hypothetical protein | - |
NWA03_RS02575 (544732) | 544732..545016 | + | 285 | WP_192917775.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
NWA03_RS02580 (545051) | 545051..545590 | + | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
NWA03_RS02585 (545600) | 545600..548038 | + | 2439 | WP_023224120.1 | F4 (K88) fimbrial usher FaeD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeC / faeD / faeE / faeF / faeH / faeI | 540429..556196 | 15767 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T254087 WP_000625911.1 NZ_CP102739:542683-543174 [Salmonella enterica subsp. enterica serovar Kentucky]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT254087 WP_001271379.1 NZ_CP102739:542393-542686 [Salmonella enterica subsp. enterica serovar Kentucky]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |