Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2500002..2500524 | Replicon | chromosome |
Accession | NZ_CP102719 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky isolate AH19MCS1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NWA05_RS12140 | Protein ID | WP_000221345.1 |
Coordinates | 2500002..2500286 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NWA05_RS12145 | Protein ID | WP_000885424.1 |
Coordinates | 2500276..2500524 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWA05_RS12120 (2496077) | 2496077..2497585 | - | 1509 | WP_023223898.1 | FAD-dependent oxidoreductase | - |
NWA05_RS12125 (2497630) | 2497630..2498118 | + | 489 | WP_023223899.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NWA05_RS12130 (2498311) | 2498311..2499390 | + | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NWA05_RS12135 (2499442) | 2499442..2499831 | - | 390 | WP_000194089.1 | RidA family protein | - |
NWA05_RS12140 (2500002) | 2500002..2500286 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWA05_RS12145 (2500276) | 2500276..2500524 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NWA05_RS12150 (2500676) | 2500676..2500795 | + | 120 | Protein_2359 | type II and III secretion system | - |
NWA05_RS12155 (2500881) | 2500881..2501212 | + | 332 | Protein_2360 | DUF1493 family protein | - |
NWA05_RS12160 (2501485) | 2501485..2502393 | + | 909 | WP_077906523.1 | hypothetical protein | - |
NWA05_RS12165 (2502395) | 2502395..2503134 | - | 740 | Protein_2362 | hypothetical protein | - |
NWA05_RS12170 (2503500) | 2503500..2503688 | - | 189 | WP_001276021.1 | DUF29 family protein | - |
NWA05_RS12175 (2504090) | 2504090..2504818 | + | 729 | WP_240856007.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2498311..2510003 | 11692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T254076 WP_000221345.1 NZ_CP102719:c2500286-2500002 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |