Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1506792..1507412 | Replicon | chromosome |
Accession | NZ_CP102719 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky isolate AH19MCS1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NWA05_RS07235 | Protein ID | WP_001280991.1 |
Coordinates | 1506792..1507010 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NWA05_RS07240 | Protein ID | WP_000344807.1 |
Coordinates | 1507038..1507412 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWA05_RS07195 (1502015) | 1502015..1502584 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
NWA05_RS07200 (1502617) | 1502617..1503006 | - | 390 | WP_023224410.1 | MGMT family protein | - |
NWA05_RS07210 (1503237) | 1503237..1504787 | - | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NWA05_RS07215 (1505012) | 1505012..1505272 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NWA05_RS07220 (1505278) | 1505278..1505418 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NWA05_RS07225 (1505474) | 1505474..1505944 | - | 471 | WP_000136183.1 | YlaC family protein | - |
NWA05_RS07230 (1506062) | 1506062..1506613 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NWA05_RS07235 (1506792) | 1506792..1507010 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NWA05_RS07240 (1507038) | 1507038..1507412 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NWA05_RS07245 (1507908) | 1507908..1511057 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NWA05_RS07250 (1511080) | 1511080..1512273 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T254075 WP_001280991.1 NZ_CP102719:c1507010-1506792 [Salmonella enterica subsp. enterica serovar Kentucky]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT254075 WP_000344807.1 NZ_CP102719:c1507412-1507038 [Salmonella enterica subsp. enterica serovar Kentucky]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|