Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 486763..487328 | Replicon | chromosome |
Accession | NZ_CP102716 | ||
Organism | Lacticaseibacillus rhamnosus strain DM065 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | NHB23_RS02270 | Protein ID | WP_005692155.1 |
Coordinates | 486981..487328 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NHB23_RS02265 | Protein ID | WP_020752297.1 |
Coordinates | 486763..486981 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHB23_RS02255 (NHB23_002255) | 483057..484847 | + | 1791 | WP_005692150.1 | ABC transporter ATP-binding protein | - |
NHB23_RS02260 (NHB23_002260) | 484834..486669 | + | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein | - |
NHB23_RS02265 (NHB23_002265) | 486763..486981 | + | 219 | WP_020752297.1 | hypothetical protein | Antitoxin |
NHB23_RS02270 (NHB23_002270) | 486981..487328 | + | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NHB23_RS02275 (NHB23_002275) | 488174..488842 | + | 669 | WP_005692157.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
NHB23_RS02280 (NHB23_002280) | 489083..489901 | + | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
NHB23_RS02285 (NHB23_002285) | 489894..490595 | + | 702 | WP_005692159.1 | ATP-binding cassette domain-containing protein | - |
NHB23_RS02290 (NHB23_002290) | 490592..491833 | + | 1242 | WP_005692160.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T254066 WP_005692155.1 NZ_CP102716:486981-487328 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|