Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 389769..390420 | Replicon | chromosome |
Accession | NZ_CP102716 | ||
Organism | Lacticaseibacillus rhamnosus strain DM065 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K8Q4Y0 |
Locus tag | NHB23_RS01795 | Protein ID | WP_005686631.1 |
Coordinates | 390037..390420 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K8QH19 |
Locus tag | NHB23_RS01790 | Protein ID | WP_005686632.1 |
Coordinates | 389769..390017 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHB23_RS01770 (NHB23_001770) | 384818..386206 | + | 1389 | WP_014571607.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
NHB23_RS01775 (NHB23_001775) | 386480..387988 | + | 1509 | WP_005686635.1 | DEAD/DEAH box helicase | - |
NHB23_RS01780 (NHB23_001780) | 388157..388531 | + | 375 | WP_005686634.1 | holo-ACP synthase | - |
NHB23_RS01785 (NHB23_001785) | 388518..389657 | + | 1140 | WP_005691215.1 | alanine racemase | - |
NHB23_RS01790 (NHB23_001790) | 389769..390017 | + | 249 | WP_005686632.1 | antitoxin | Antitoxin |
NHB23_RS01795 (NHB23_001795) | 390037..390420 | + | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NHB23_RS01800 (NHB23_001800) | 390934..391461 | + | 528 | WP_005691221.1 | QueT transporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T254065 WP_005686631.1 NZ_CP102716:390037-390420 [Lacticaseibacillus rhamnosus]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|