Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 21999..22642 | Replicon | plasmid pGN4554-3 |
Accession | NZ_CP102697 | ||
Organism | Escherichia coli strain GN4554 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | NV952_RS23935 | Protein ID | WP_001034044.1 |
Coordinates | 22226..22642 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | NV952_RS23930 | Protein ID | WP_001261286.1 |
Coordinates | 21999..22229 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV952_RS23910 (18630) | 18630..19385 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NV952_RS23915 (20107) | 20107..20913 | - | 807 | WP_000016970.1 | site-specific integrase | - |
NV952_RS23920 (20914) | 20914..21219 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
NV952_RS23925 (21221) | 21221..21439 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
NV952_RS23930 (21999) | 21999..22229 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NV952_RS23935 (22226) | 22226..22642 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NV952_RS23940 (22717) | 22717..24282 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
NV952_RS23945 (24267) | 24267..25289 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA | 1..54149 | 54149 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T254057 WP_001034044.1 NZ_CP102697:22226-22642 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |