Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 56700..57301 Replicon plasmid pGN4554-1
Accession NZ_CP102695
Organism Escherichia coli strain GN4554

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag NV952_RS23180 Protein ID WP_001216045.1
Coordinates 56700..57080 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NV952_RS23185 Protein ID WP_001190712.1
Coordinates 57080..57301 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV952_RS23155 (NV952_23085) 52141..53625 - 1485 WP_000124150.1 terminase -
NV952_RS23160 (NV952_23090) 53625..54818 - 1194 WP_000219625.1 hypothetical protein -
NV952_RS23165 (NV952_23095) 54904..55356 - 453 WP_001326849.1 late promoter-activating protein -
NV952_RS23170 (NV952_23100) 55445..56488 - 1044 WP_023356283.1 DUF968 domain-containing protein -
NV952_RS23175 (NV952_23105) 56516..56695 - 180 WP_001339207.1 hypothetical protein -
NV952_RS23180 (NV952_23110) 56700..57080 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NV952_RS23185 (NV952_23115) 57080..57301 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NV952_RS23190 (NV952_23120) 57374..57763 - 390 WP_000506730.1 S24 family peptidase -
NV952_RS23195 (NV952_23125) 57938..58177 + 240 WP_223368633.1 hypothetical protein -
NV952_RS23200 (NV952_23130) 58155..58529 + 375 Protein_59 integrase core domain-containing protein -
NV952_RS23205 (NV952_23135) 59100..60956 - 1857 WP_077902027.1 acyltransferase family protein -
NV952_RS23210 (NV952_23140) 61182..61928 + 747 Protein_61 IS1 family transposase -
NV952_RS23215 (NV952_23145) 62027..62206 - 180 Protein_62 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..84427 84427
- flank IS/Tn - - 58155..58529 374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T254048 WP_001216045.1 NZ_CP102695:c57080-56700 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT254048 WP_001190712.1 NZ_CP102695:c57301-57080 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References