Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 127910..128646 | Replicon | plasmid pGN4542-1 |
Accession | NZ_CP102693 | ||
Organism | Klebsiella pneumoniae strain GN4542 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A486JQ35 |
Locus tag | NV951_RS26360 | Protein ID | WP_049109282.1 |
Coordinates | 127910..128392 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NV951_RS26365 | Protein ID | WP_003026799.1 |
Coordinates | 128380..128646 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV951_RS26330 (NV951_26325) | 123130..124095 | + | 966 | WP_004118146.1 | DMT family transporter | - |
NV951_RS26335 (NV951_26330) | 124163..124291 | - | 129 | Protein_135 | transcriptional regulator | - |
NV951_RS26340 (NV951_26335) | 124351..124965 | - | 615 | WP_023316428.1 | hypothetical protein | - |
NV951_RS26345 (NV951_26340) | 125146..125343 | - | 198 | Protein_137 | hypothetical protein | - |
NV951_RS26350 (NV951_26345) | 125646..126278 | + | 633 | WP_001567369.1 | hypothetical protein | - |
NV951_RS26355 (NV951_26350) | 126307..127710 | - | 1404 | WP_275622086.1 | ISNCY-like element ISKpn21 family transposase | - |
NV951_RS26360 (NV951_26355) | 127910..128392 | - | 483 | WP_049109282.1 | GNAT family N-acetyltransferase | Toxin |
NV951_RS26365 (NV951_26360) | 128380..128646 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NV951_RS26370 (NV951_26365) | 128932..129039 | + | 108 | Protein_142 | transposase | - |
NV951_RS26375 (NV951_26370) | 129082..129897 | - | 816 | WP_049109278.1 | hypothetical protein | - |
NV951_RS26380 (NV951_26375) | 130185..131210 | + | 1026 | WP_064782720.1 | IS110 family transposase | - |
NV951_RS26385 (NV951_26380) | 131549..132472 | + | 924 | WP_049108798.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA1 / qacE / sul1 / qnrB4 / blaDHA-1 | - | 1..178593 | 178593 | |
- | inside | IScluster/Tn | - | - | 126307..139566 | 13259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17336.86 Da Isoelectric Point: 8.0020
>T254031 WP_049109282.1 NZ_CP102693:c128392-127910 [Klebsiella pneumoniae]
VGRITAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCETGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRITAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCETGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486JQ35 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |