Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 10945..11588 | Replicon | plasmid pGN4542-1 |
Accession | NZ_CP102693 | ||
Organism | Klebsiella pneumoniae strain GN4542 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | NV951_RS25745 | Protein ID | WP_001044770.1 |
Coordinates | 11172..11588 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | NV951_RS25740 | Protein ID | WP_001261282.1 |
Coordinates | 10945..11175 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV951_RS25690 (NV951_25685) | 6494..6607 | + | 114 | WP_014343462.1 | hypothetical protein | - |
NV951_RS25695 (NV951_25690) | 6736..6993 | + | 258 | WP_009310077.1 | hypothetical protein | - |
NV951_RS25700 (NV951_25695) | 7051..7830 | - | 780 | WP_023287113.1 | site-specific integrase | - |
NV951_RS25705 (NV951_25700) | 7823..7984 | - | 162 | WP_009483881.1 | hypothetical protein | - |
NV951_RS25710 (NV951_25705) | 8028..9044 | - | 1017 | WP_009309921.1 | hypothetical protein | - |
NV951_RS25715 (NV951_25710) | 9078..9413 | - | 336 | WP_009309920.1 | hypothetical protein | - |
NV951_RS25720 (NV951_25715) | 9463..9603 | - | 141 | WP_162898808.1 | hypothetical protein | - |
NV951_RS25725 (NV951_25720) | 9832..10137 | - | 306 | WP_009309918.1 | type II toxin-antitoxin system toxin CcdB | - |
NV951_RS25730 (NV951_25725) | 10139..10357 | - | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | - |
NV951_RS25735 (NV951_25730) | 10527..10988 | - | 462 | WP_075212430.1 | hypothetical protein | - |
NV951_RS25740 (NV951_25735) | 10945..11175 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NV951_RS25745 (NV951_25740) | 11172..11588 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NV951_RS25750 (NV951_25745) | 11662..13224 | + | 1563 | WP_009309907.1 | AAA family ATPase | - |
NV951_RS25755 (NV951_25750) | 13209..14231 | + | 1023 | WP_049109415.1 | helicase UvrD | - |
NV951_RS25760 (NV951_25755) | 14775..15683 | + | 909 | WP_032425603.1 | HNH endonuclease | - |
NV951_RS25765 (NV951_25760) | 15869..16219 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA1 / qacE / sul1 / qnrB4 / blaDHA-1 | - | 1..178593 | 178593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T254030 WP_001044770.1 NZ_CP102693:11172-11588 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |