Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 9832..10357 Replicon plasmid pGN4542-1
Accession NZ_CP102693
Organism Klebsiella pneumoniae strain GN4542

Toxin (Protein)


Gene name ccdB Uniprot ID A0A7H9GHC5
Locus tag NV951_RS25725 Protein ID WP_009309918.1
Coordinates 9832..10137 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag NV951_RS25730 Protein ID WP_006788213.1
Coordinates 10139..10357 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV951_RS25685 (NV951_25680) 5017..5985 - 969 WP_275622088.1 IS5 family transposase -
NV951_RS25690 (NV951_25685) 6494..6607 + 114 WP_014343462.1 hypothetical protein -
NV951_RS25695 (NV951_25690) 6736..6993 + 258 WP_009310077.1 hypothetical protein -
NV951_RS25700 (NV951_25695) 7051..7830 - 780 WP_023287113.1 site-specific integrase -
NV951_RS25705 (NV951_25700) 7823..7984 - 162 WP_009483881.1 hypothetical protein -
NV951_RS25710 (NV951_25705) 8028..9044 - 1017 WP_009309921.1 hypothetical protein -
NV951_RS25715 (NV951_25710) 9078..9413 - 336 WP_009309920.1 hypothetical protein -
NV951_RS25720 (NV951_25715) 9463..9603 - 141 WP_162898808.1 hypothetical protein -
NV951_RS25725 (NV951_25720) 9832..10137 - 306 WP_009309918.1 type II toxin-antitoxin system toxin CcdB Toxin
NV951_RS25730 (NV951_25725) 10139..10357 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NV951_RS25735 (NV951_25730) 10527..10988 - 462 WP_075212430.1 hypothetical protein -
NV951_RS25740 (NV951_25735) 10945..11175 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NV951_RS25745 (NV951_25740) 11172..11588 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NV951_RS25750 (NV951_25745) 11662..13224 + 1563 WP_009309907.1 AAA family ATPase -
NV951_RS25755 (NV951_25750) 13209..14231 + 1023 WP_049109415.1 helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA1 / qacE / sul1 / qnrB4 / blaDHA-1 - 1..178593 178593


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11571.24 Da        Isoelectric Point: 6.4661

>T254029 WP_009309918.1 NZ_CP102693:c10137-9832 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVVPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT254029 WP_006788213.1 NZ_CP102693:c10357-10139 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9GHC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References