Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5186854..5187479 | Replicon | chromosome |
Accession | NZ_CP102692 | ||
Organism | Klebsiella pneumoniae strain GN4542 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NV951_RS25295 | Protein ID | WP_002882817.1 |
Coordinates | 5186854..5187237 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NV951_RS25300 | Protein ID | WP_004150355.1 |
Coordinates | 5187237..5187479 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV951_RS25280 (NV951_25275) | 5184220..5185122 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NV951_RS25285 (NV951_25280) | 5185119..5185754 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NV951_RS25290 (NV951_25285) | 5185751..5186680 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NV951_RS25295 (NV951_25290) | 5186854..5187237 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NV951_RS25300 (NV951_25295) | 5187237..5187479 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NV951_RS25305 (NV951_25300) | 5187684..5188601 | + | 918 | WP_049109136.1 | alpha/beta hydrolase | - |
NV951_RS25310 (NV951_25305) | 5188615..5189556 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NV951_RS25315 (NV951_25310) | 5189601..5190038 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NV951_RS25320 (NV951_25315) | 5190035..5190895 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
NV951_RS25325 (NV951_25320) | 5190889..5191488 | - | 600 | WP_004146231.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T254028 WP_002882817.1 NZ_CP102692:c5187237-5186854 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |