Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4717219..4717735 | Replicon | chromosome |
Accession | NZ_CP102692 | ||
Organism | Klebsiella pneumoniae strain GN4542 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NV951_RS23065 | Protein ID | WP_049110203.1 |
Coordinates | 4717219..4717503 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NV951_RS23070 | Protein ID | WP_002886901.1 |
Coordinates | 4717493..4717735 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV951_RS23040 (NV951_23035) | 4712703..4712966 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
NV951_RS23045 (NV951_23040) | 4713096..4713269 | + | 174 | WP_002886906.1 | hypothetical protein | - |
NV951_RS23050 (NV951_23045) | 4713272..4714015 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NV951_RS23055 (NV951_23050) | 4714372..4716510 | + | 2139 | WP_049110202.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NV951_RS23060 (NV951_23055) | 4716751..4717215 | + | 465 | WP_032418146.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NV951_RS23065 (NV951_23060) | 4717219..4717503 | - | 285 | WP_049110203.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NV951_RS23070 (NV951_23065) | 4717493..4717735 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NV951_RS23075 (NV951_23070) | 4717813..4719723 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NV951_RS23080 (NV951_23075) | 4719746..4720900 | - | 1155 | WP_023159544.1 | lactonase family protein | - |
NV951_RS23085 (NV951_23080) | 4720967..4721707 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11093.95 Da Isoelectric Point: 10.4962
>T254026 WP_049110203.1 NZ_CP102692:c4717503-4717219 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|