Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3967415..3968034 | Replicon | chromosome |
| Accession | NZ_CP102692 | ||
| Organism | Klebsiella pneumoniae strain GN4542 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NV951_RS19520 | Protein ID | WP_002892050.1 |
| Coordinates | 3967816..3968034 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NV951_RS19515 | Protein ID | WP_049108832.1 |
| Coordinates | 3967415..3967789 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV951_RS19505 (NV951_19500) | 3962567..3963760 | + | 1194 | WP_049108834.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NV951_RS19510 (NV951_19505) | 3963783..3966929 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NV951_RS19515 (NV951_19510) | 3967415..3967789 | + | 375 | WP_049108832.1 | Hha toxicity modulator TomB | Antitoxin |
| NV951_RS19520 (NV951_19515) | 3967816..3968034 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NV951_RS19525 (NV951_19520) | 3968193..3968759 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NV951_RS19530 (NV951_19525) | 3968731..3968871 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NV951_RS19535 (NV951_19530) | 3968892..3969362 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NV951_RS19540 (NV951_19535) | 3969337..3970788 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NV951_RS19545 (NV951_19540) | 3970889..3971587 | + | 699 | WP_004177238.1 | GNAT family protein | - |
| NV951_RS19550 (NV951_19545) | 3971584..3971724 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NV951_RS19555 (NV951_19550) | 3971724..3971987 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T254024 WP_002892050.1 NZ_CP102692:3967816-3968034 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14354.03 Da Isoelectric Point: 4.8989
>AT254024 WP_049108832.1 NZ_CP102692:3967415-3967789 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIGQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIGQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|