Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 27270..27913 | Replicon | plasmid pGN4539-3 |
| Accession | NZ_CP102690 | ||
| Organism | Klebsiella pneumoniae strain GN4539 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | NV950_RS27895 | Protein ID | WP_000754566.1 |
| Coordinates | 27270..27686 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NV950_RS27900 | Protein ID | WP_001261276.1 |
| Coordinates | 27683..27913 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV950_RS27870 (NV950_27855) | 22672..23376 | - | 705 | WP_004228310.1 | IS6-like element IS26 family transposase | - |
| NV950_RS27875 (NV950_27860) | 23444..23965 | + | 522 | Protein_26 | Tn3 family transposase | - |
| NV950_RS27880 (NV950_27865) | 24128..24211 | - | 84 | Protein_27 | SOS response-associated peptidase | - |
| NV950_RS27885 (NV950_27870) | 24852..25928 | - | 1077 | WP_000227969.1 | IS110 family transposase | - |
| NV950_RS27890 (NV950_27875) | 26210..27066 | - | 857 | Protein_29 | IS3-like element ISEc15 family transposase | - |
| NV950_RS27895 (NV950_27880) | 27270..27686 | - | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NV950_RS27900 (NV950_27885) | 27683..27913 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NV950_RS27905 (NV950_27890) | 28487..28837 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| NV950_RS27910 (NV950_27895) | 28888..29631 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| NV950_RS27915 (NV950_27900) | 29628..30404 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| NV950_RS27920 (NV950_27905) | 30462..30719 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| NV950_RS27925 (NV950_27910) | 30848..30952 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| NV950_RS27930 (NV950_27915) | 31482..32348 | + | 867 | WP_004118283.1 | replication initiation protein | - |
| NV950_RS27935 (NV950_27920) | 32525..32794 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) | - | 1..38759 | 38759 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T254015 WP_000754566.1 NZ_CP102690:c27686-27270 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |