Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 27270..27913 Replicon plasmid pGN4539-3
Accession NZ_CP102690
Organism Klebsiella pneumoniae strain GN4539

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag NV950_RS27895 Protein ID WP_000754566.1
Coordinates 27270..27686 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag NV950_RS27900 Protein ID WP_001261276.1
Coordinates 27683..27913 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV950_RS27870 (NV950_27855) 22672..23376 - 705 WP_004228310.1 IS6-like element IS26 family transposase -
NV950_RS27875 (NV950_27860) 23444..23965 + 522 Protein_26 Tn3 family transposase -
NV950_RS27880 (NV950_27865) 24128..24211 - 84 Protein_27 SOS response-associated peptidase -
NV950_RS27885 (NV950_27870) 24852..25928 - 1077 WP_000227969.1 IS110 family transposase -
NV950_RS27890 (NV950_27875) 26210..27066 - 857 Protein_29 IS3-like element ISEc15 family transposase -
NV950_RS27895 (NV950_27880) 27270..27686 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
NV950_RS27900 (NV950_27885) 27683..27913 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NV950_RS27905 (NV950_27890) 28487..28837 + 351 WP_000493378.1 hypothetical protein -
NV950_RS27910 (NV950_27895) 28888..29631 + 744 WP_000129823.1 hypothetical protein -
NV950_RS27915 (NV950_27900) 29628..30404 + 777 WP_000015958.1 site-specific integrase -
NV950_RS27920 (NV950_27905) 30462..30719 - 258 WP_000764642.1 hypothetical protein -
NV950_RS27925 (NV950_27910) 30848..30952 - 105 WP_032409716.1 hypothetical protein -
NV950_RS27930 (NV950_27915) 31482..32348 + 867 WP_004118283.1 replication initiation protein -
NV950_RS27935 (NV950_27920) 32525..32794 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) - 1..38759 38759


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T254015 WP_000754566.1 NZ_CP102690:c27686-27270 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT254015 WP_001261276.1 NZ_CP102690:c27913-27683 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References