Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4428424..4429081 | Replicon | chromosome |
| Accession | NZ_CP102687 | ||
| Organism | Klebsiella pneumoniae strain GN4539 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NV950_RS21875 | Protein ID | WP_002916310.1 |
| Coordinates | 4428671..4429081 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NV950_RS21870 | Protein ID | WP_002916312.1 |
| Coordinates | 4428424..4428690 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV950_RS21845 (NV950_21840) | 4423580..4425013 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| NV950_RS21850 (NV950_21845) | 4425132..4425860 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NV950_RS21855 (NV950_21850) | 4425910..4426221 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| NV950_RS21860 (NV950_21855) | 4426385..4427044 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NV950_RS21865 (NV950_21860) | 4427195..4428178 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| NV950_RS21870 (NV950_21865) | 4428424..4428690 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NV950_RS21875 (NV950_21870) | 4428671..4429081 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NV950_RS21880 (NV950_21875) | 4429088..4429609 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| NV950_RS21885 (NV950_21880) | 4429710..4430606 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NV950_RS21890 (NV950_21885) | 4430629..4431342 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NV950_RS21895 (NV950_21890) | 4431348..4433081 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T254013 WP_002916310.1 NZ_CP102687:4428671-4429081 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |