Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2965683..2966199 | Replicon | chromosome |
| Accession | NZ_CP102687 | ||
| Organism | Klebsiella pneumoniae strain GN4539 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | NV950_RS14600 | Protein ID | WP_002886902.1 |
| Coordinates | 2965683..2965967 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NV950_RS14605 | Protein ID | WP_002886901.1 |
| Coordinates | 2965957..2966199 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV950_RS14575 (NV950_14570) | 2961167..2961475 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
| NV950_RS14580 (NV950_14575) | 2961560..2961733 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| NV950_RS14585 (NV950_14580) | 2961736..2962479 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NV950_RS14590 (NV950_14585) | 2962836..2964974 | + | 2139 | WP_042943710.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NV950_RS14595 (NV950_14590) | 2965215..2965679 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NV950_RS14600 (NV950_14595) | 2965683..2965967 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NV950_RS14605 (NV950_14600) | 2965957..2966199 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NV950_RS14610 (NV950_14605) | 2966277..2968187 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NV950_RS14615 (NV950_14610) | 2968210..2969364 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NV950_RS14620 (NV950_14615) | 2969430..2970170 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T254007 WP_002886902.1 NZ_CP102687:c2965967-2965683 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |