Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2250914..2251533 Replicon chromosome
Accession NZ_CP102687
Organism Klebsiella pneumoniae strain GN4539

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NV950_RS11170 Protein ID WP_002892050.1
Coordinates 2251315..2251533 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NV950_RS11165 Protein ID WP_002892066.1
Coordinates 2250914..2251288 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV950_RS11155 (NV950_11150) 2246066..2247259 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NV950_RS11160 (NV950_11155) 2247282..2250428 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NV950_RS11165 (NV950_11160) 2250914..2251288 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NV950_RS11170 (NV950_11165) 2251315..2251533 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NV950_RS11175 (NV950_11170) 2251692..2252258 + 567 WP_002892030.1 maltose O-acetyltransferase -
NV950_RS11180 (NV950_11175) 2252230..2252370 - 141 WP_004147370.1 hypothetical protein -
NV950_RS11185 (NV950_11180) 2252391..2252861 + 471 WP_002892026.1 YlaC family protein -
NV950_RS11190 (NV950_11185) 2252836..2254287 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NV950_RS11195 (NV950_11190) 2254388..2255086 + 699 WP_002892021.1 GNAT family protein -
NV950_RS11200 (NV950_11195) 2255083..2255223 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NV950_RS11205 (NV950_11200) 2255223..2255486 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254005 WP_002892050.1 NZ_CP102687:2251315-2251533 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254005 WP_002892066.1 NZ_CP102687:2250914-2251288 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References