Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2481851..2482479 | Replicon | chromosome |
Accession | NZ_CP102682 | ||
Organism | Leptospira borgpetersenii serovar Javanica strain 4-I |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M6E4U3 |
Locus tag | LIX27_RS10640 | Protein ID | WP_002724218.1 |
Coordinates | 2482078..2482479 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LIX27_RS10635 | Protein ID | WP_010705987.1 |
Coordinates | 2481851..2482081 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX27_RS10620 (LIX27_10620) | 2479824..2480204 | - | 381 | WP_258203851.1 | hypothetical protein | - |
LIX27_RS10625 (LIX27_10625) | 2480706..2480934 | - | 229 | Protein_2095 | hypothetical protein | - |
LIX27_RS10630 (LIX27_10630) | 2481448..2481585 | - | 138 | WP_002736206.1 | hypothetical protein | - |
LIX27_RS10635 (LIX27_10635) | 2481851..2482081 | + | 231 | WP_010705987.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LIX27_RS10640 (LIX27_10640) | 2482078..2482479 | + | 402 | WP_002724218.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LIX27_RS10645 (LIX27_10645) | 2482625..2482804 | - | 180 | WP_002724268.1 | hypothetical protein | - |
LIX27_RS10650 (LIX27_10650) | 2482914..2484596 | - | 1683 | WP_002724258.1 | dihydroxy-acid dehydratase | - |
LIX27_RS10655 (LIX27_10655) | 2485005..2485550 | + | 546 | WP_170874669.1 | metal-dependent hydrolase | - |
LIX27_RS10660 (LIX27_10660) | 2486343..2486633 | + | 291 | WP_002736220.1 | YciI family protein | - |
LIX27_RS10665 (LIX27_10665) | 2486642..2487338 | - | 697 | Protein_2103 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15501.23 Da Isoelectric Point: 9.9288
>T253999 WP_002724218.1 NZ_CP102682:2482078-2482479 [Leptospira borgpetersenii serovar Javanica]
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|