Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2481866..2482494 | Replicon | chromosome |
| Accession | NZ_CP102680 | ||
| Organism | Leptospira borgpetersenii serovar Javanica strain I2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M6E4U3 |
| Locus tag | NU962_RS10600 | Protein ID | WP_002724218.1 |
| Coordinates | 2482093..2482494 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NU962_RS10595 | Protein ID | WP_010705987.1 |
| Coordinates | 2481866..2482096 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU962_RS10580 (NU962_10580) | 2479839..2480537 | - | 699 | WP_002724172.1 | hypothetical protein | - |
| NU962_RS10585 (NU962_10585) | 2480720..2480948 | - | 229 | Protein_2087 | hypothetical protein | - |
| NU962_RS10590 (NU962_10590) | 2481463..2481600 | - | 138 | WP_002736206.1 | hypothetical protein | - |
| NU962_RS10595 (NU962_10595) | 2481866..2482096 | + | 231 | WP_010705987.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NU962_RS10600 (NU962_10600) | 2482093..2482494 | + | 402 | WP_002724218.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NU962_RS10605 (NU962_10605) | 2482640..2482819 | - | 180 | WP_002724268.1 | hypothetical protein | - |
| NU962_RS10610 (NU962_10610) | 2482929..2484611 | - | 1683 | WP_002724258.1 | dihydroxy-acid dehydratase | - |
| NU962_RS10615 (NU962_10615) | 2485020..2485565 | + | 546 | WP_170874669.1 | metal-dependent hydrolase | - |
| NU962_RS10620 (NU962_10620) | 2486358..2486648 | + | 291 | WP_002736220.1 | YciI family protein | - |
| NU962_RS10625 (NU962_10625) | 2486657..2487353 | - | 697 | Protein_2095 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15501.23 Da Isoelectric Point: 9.9288
>T253996 WP_002724218.1 NZ_CP102680:2482093-2482494 [Leptospira borgpetersenii serovar Javanica]
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|