Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazE-MazF |
Location | 480648..481213 | Replicon | chromosome |
Accession | NZ_CP102680 | ||
Organism | Leptospira borgpetersenii serovar Javanica strain I2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V6I350 |
Locus tag | NU962_RS02105 | Protein ID | WP_002753850.1 |
Coordinates | 480648..480896 (+) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NU962_RS02110 | Protein ID | WP_011670965.1 |
Coordinates | 480890..481213 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU962_RS02085 (NU962_02085) | 475697..476698 | + | 1002 | WP_002732926.1 | metallophosphoesterase | - |
NU962_RS02090 (NU962_02090) | 476701..477378 | + | 678 | WP_002725755.1 | hypothetical protein | - |
NU962_RS02095 (NU962_02095) | 477375..477791 | + | 417 | WP_002725741.1 | hypothetical protein | - |
NU962_RS02100 (NU962_02100) | 477772..479952 | + | 2181 | WP_002759426.1 | ATP-dependent DNA helicase RecG | - |
NU962_RS02105 (NU962_02105) | 480648..480896 | + | 249 | WP_002753850.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Toxin |
NU962_RS02110 (NU962_02110) | 480890..481213 | + | 324 | WP_011670965.1 | type II toxin-antitoxin system PemK/MazF family toxin | Antitoxin |
NU962_RS02115 (NU962_02115) | 481649..483184 | + | 1536 | WP_258203911.1 | phosphomethylpyrimidine synthase ThiC | - |
NU962_RS02120 (NU962_02120) | 483563..484216 | + | 654 | Protein_413 | helicase-related protein | - |
NU962_RS02125 (NU962_02125) | 484591..484935 | - | 345 | WP_002728323.1 | TIGR04452 family lipoprotein | - |
NU962_RS02130 (NU962_02130) | 485269..486012 | + | 744 | WP_002728313.1 | M15 family metallopeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 9459.00 Da Isoelectric Point: 5.1749
>T253994 WP_002753850.1 NZ_CP102680:480648-480896 [Leptospira borgpetersenii serovar Javanica]
MKALVVKIGNSKGIRIPKAVLEECHIEEEVDLLIDNNKLIIVPLKSKPREGWEKQFKSMSSNKDDKLLIPDSIDLSDKDW
EW
MKALVVKIGNSKGIRIPKAVLEECHIEEEVDLLIDNNKLIIVPLKSKPREGWEKQFKSMSSNKDDKLLIPDSIDLSDKDW
EW
Download Length: 249 bp
Antitoxin
Download Length: 108 a.a. Molecular weight: 12296.80 Da Isoelectric Point: 10.5161
>AT253994 WP_011670965.1 NZ_CP102680:480890-481213 [Leptospira borgpetersenii serovar Javanica]
MVISQYEVYLINLDPTVGHEIKKSRPCVIISPNEMNKTIGTIIITPMTTKSRSYPTRVELTFQGKKGWIVLDQIRTVDKI
RLIKKLGKIDPKTVNKMKLIIKEMLVD
MVISQYEVYLINLDPTVGHEIKKSRPCVIISPNEMNKTIGTIIITPMTTKSRSYPTRVELTFQGKKGWIVLDQIRTVDKI
RLIKKLGKIDPKTVNKMKLIIKEMLVD
Download Length: 324 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|