Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3936048..3936883 Replicon chromosome
Accession NZ_CP102679
Organism Escherichia coli strain XH989

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0J2AEA6
Locus tag NU949_RS21355 Protein ID WP_000854759.1
Coordinates 3936048..3936425 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NU949_RS21360 Protein ID WP_001295723.1
Coordinates 3936515..3936883 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU949_RS21330 (3932437) 3932437..3933978 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NU949_RS21335 (3934572) 3934572..3934748 - 177 Protein_3769 helix-turn-helix domain-containing protein -
NU949_RS21340 (3935115) 3935115..3935264 - 150 Protein_3770 hypothetical protein -
NU949_RS21345 (3935370) 3935370..3935546 - 177 WP_000839286.1 DUF957 domain-containing protein -
NU949_RS21350 (3935563) 3935563..3936051 - 489 WP_000761690.1 DUF5983 family protein -
NU949_RS21355 (3936048) 3936048..3936425 - 378 WP_000854759.1 TA system toxin CbtA family protein Toxin
NU949_RS21360 (3936515) 3936515..3936883 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NU949_RS21365 (3937046) 3937046..3937267 - 222 WP_000692345.1 DUF987 domain-containing protein -
NU949_RS21370 (3937330) 3937330..3937806 - 477 WP_001186775.1 RadC family protein -
NU949_RS21375 (3937822) 3937822..3938295 - 474 WP_000855059.1 antirestriction protein -
NU949_RS21380 (3938635) 3938635..3939453 - 819 WP_042631095.1 DUF932 domain-containing protein -
NU949_RS21385 (3939571) 3939571..3939766 - 196 Protein_3779 DUF905 family protein -
NU949_RS21390 (3939837) 3939837..3940055 - 219 WP_072649508.1 autotransporter domain-containing protein -
NU949_RS21395 (3940112) 3940112..3941134 + 1023 WP_000255946.1 IS21-like element IS100 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaCTX-M-55 cheD / fimH / fimG / fimF / fimD / fimC / fimI / fimA / fimE / fimB 3769809..3941514 171705
- flank IS/Tn - - 3932437..3933978 1541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14144.26 Da        Isoelectric Point: 7.3249

>T253989 WP_000854759.1 NZ_CP102679:c3936425-3936048 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT253989 WP_001295723.1 NZ_CP102679:c3936883-3936515 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2AEA6

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References