Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3936048..3936883 | Replicon | chromosome |
| Accession | NZ_CP102679 | ||
| Organism | Escherichia coli strain XH989 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | NU949_RS21355 | Protein ID | WP_000854759.1 |
| Coordinates | 3936048..3936425 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NU949_RS21360 | Protein ID | WP_001295723.1 |
| Coordinates | 3936515..3936883 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU949_RS21330 (3932437) | 3932437..3933978 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| NU949_RS21335 (3934572) | 3934572..3934748 | - | 177 | Protein_3769 | helix-turn-helix domain-containing protein | - |
| NU949_RS21340 (3935115) | 3935115..3935264 | - | 150 | Protein_3770 | hypothetical protein | - |
| NU949_RS21345 (3935370) | 3935370..3935546 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| NU949_RS21350 (3935563) | 3935563..3936051 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| NU949_RS21355 (3936048) | 3936048..3936425 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| NU949_RS21360 (3936515) | 3936515..3936883 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NU949_RS21365 (3937046) | 3937046..3937267 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NU949_RS21370 (3937330) | 3937330..3937806 | - | 477 | WP_001186775.1 | RadC family protein | - |
| NU949_RS21375 (3937822) | 3937822..3938295 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NU949_RS21380 (3938635) | 3938635..3939453 | - | 819 | WP_042631095.1 | DUF932 domain-containing protein | - |
| NU949_RS21385 (3939571) | 3939571..3939766 | - | 196 | Protein_3779 | DUF905 family protein | - |
| NU949_RS21390 (3939837) | 3939837..3940055 | - | 219 | WP_072649508.1 | autotransporter domain-containing protein | - |
| NU949_RS21395 (3940112) | 3940112..3941134 | + | 1023 | WP_000255946.1 | IS21-like element IS100 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaCTX-M-55 | cheD / fimH / fimG / fimF / fimD / fimC / fimI / fimA / fimE / fimB | 3769809..3941514 | 171705 | |
| - | flank | IS/Tn | - | - | 3932437..3933978 | 1541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T253989 WP_000854759.1 NZ_CP102679:c3936425-3936048 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT253989 WP_001295723.1 NZ_CP102679:c3936883-3936515 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |