Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3237370..3238207 | Replicon | chromosome |
Accession | NZ_CP102679 | ||
Organism | Escherichia coli strain XH989 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NU949_RS17945 | Protein ID | WP_000227784.1 |
Coordinates | 3237665..3238207 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NU949_RS17940 | Protein ID | WP_001297137.1 |
Coordinates | 3237370..3237681 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU949_RS17915 (3232390) | 3232390..3233337 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NU949_RS17920 (3233359) | 3233359..3235350 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NU949_RS17925 (3235340) | 3235340..3235954 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NU949_RS17930 (3235954) | 3235954..3236283 | + | 330 | WP_072649523.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NU949_RS17935 (3236295) | 3236295..3237185 | + | 891 | WP_000971336.1 | heme o synthase | - |
NU949_RS17940 (3237370) | 3237370..3237681 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NU949_RS17945 (3237665) | 3237665..3238207 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NU949_RS17950 (3238263) | 3238263..3239198 | - | 936 | WP_001365761.1 | tetratricopeptide repeat protein | - |
NU949_RS17955 (3239606) | 3239606..3240970 | + | 1365 | WP_001000974.1 | MFS transporter | - |
NU949_RS17960 (3241098) | 3241098..3241589 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NU949_RS17965 (3241757) | 3241757..3242668 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T253986 WP_000227784.1 NZ_CP102679:3237665-3238207 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|