Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3203294..3203912 | Replicon | chromosome |
Accession | NZ_CP102679 | ||
Organism | Escherichia coli strain XH989 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NU949_RS17775 | Protein ID | WP_001291435.1 |
Coordinates | 3203694..3203912 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NU949_RS17770 | Protein ID | WP_000344800.1 |
Coordinates | 3203294..3203668 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU949_RS17760 (3198383) | 3198383..3199576 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NU949_RS17765 (3199599) | 3199599..3202748 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NU949_RS17770 (3203294) | 3203294..3203668 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NU949_RS17775 (3203694) | 3203694..3203912 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NU949_RS17780 (3204083) | 3204083..3204634 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NU949_RS17785 (3204750) | 3204750..3205220 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NU949_RS17790 (3205384) | 3205384..3206934 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NU949_RS17795 (3206976) | 3206976..3207329 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
NU949_RS17805 (3207708) | 3207708..3208019 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NU949_RS17810 (3208050) | 3208050..3208622 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253985 WP_001291435.1 NZ_CP102679:3203694-3203912 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253985 WP_000344800.1 NZ_CP102679:3203294-3203668 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |