Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2214735..2215373 | Replicon | chromosome |
| Accession | NZ_CP102679 | ||
| Organism | Escherichia coli strain XH989 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NU949_RS12990 | Protein ID | WP_000813794.1 |
| Coordinates | 2215197..2215373 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NU949_RS12985 | Protein ID | WP_001270286.1 |
| Coordinates | 2214735..2215151 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU949_RS12965 (2209887) | 2209887..2210828 | - | 942 | WP_072649490.1 | ABC transporter permease | - |
| NU949_RS12970 (2210829) | 2210829..2211842 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NU949_RS12975 (2211860) | 2211860..2213005 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NU949_RS12980 (2213250) | 2213250..2214656 | - | 1407 | WP_000760592.1 | PLP-dependent aminotransferase family protein | - |
| NU949_RS12985 (2214735) | 2214735..2215151 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NU949_RS12990 (2215197) | 2215197..2215373 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NU949_RS12995 (2215595) | 2215595..2215825 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NU949_RS13000 (2215917) | 2215917..2217878 | - | 1962 | WP_001593323.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NU949_RS13005 (2217951) | 2217951..2218487 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NU949_RS13010 (2218579) | 2218579..2219754 | + | 1176 | WP_001236215.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T253984 WP_000813794.1 NZ_CP102679:c2215373-2215197 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT253984 WP_001270286.1 NZ_CP102679:c2215151-2214735 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|